PMCCPMCCPMCC

Search tips
Search criteria 

Advanced

Logo of nihpaAbout Author manuscriptsSubmit a manuscriptHHS Public Access; Author Manuscript; Accepted for publication in peer reviewed journal;
 
From:
J Immunol. Author manuscript; available in PMC 2012 August 1.
Published in final edited form as:
J Immunol. 2011 August 1; 187(3): 1403–1410.
Published online 2011 June 29. doi: 10.4049/jimmunol.1002352

Table I

Comparison of chemerin isoforms used in this study.

Chemerin formAbbreviationsC-term amino acid sequence with residue position in Italics. Non native aa are shown in bold.Ref.
Pro-chemerin (full-length chemerin)Pro-chem111 VLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS 163(7)
Serum formchemA155111 VLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAPH 155(7, 21)
Staphopain B-treated chemerinChem/SspB chemS157
minor form chemS148
111 VLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS 157
111 VLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHS 148
(13)
Cat L –treated chemerin
Cat K-treated chemerin
chemS157
chemR125
111 VLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS 157
111 VLGRLVHCPIETQVLR 125
This work