PMCCPMCCPMCC

Search tips
Search criteria 

Advanced

 
Logo of mbcLink to Publisher's site
 
Mol Biol Cell. 2010 February 15; 21(4): 511–520.
PMCID: PMC2820417

Alzheimer Aβ Peptide Induces Chromosome Mis-Segregation and Aneuploidy, Including Trisomy 21: Requirement for Tau and APP

Antoneta Granic,*§ Jaya Padmanabhan,* Michelle Norden,* and Huntington Pottercorresponding author*§
Yixian Zheng, Monitoring Editor

Abstract

Both sporadic and familial Alzheimer's disease (AD) patients exhibit increased chromosome aneuploidy, particularly trisomy 21, in neurons and other cells. Significantly, trisomy 21/Down syndrome patients develop early onset AD pathology. We investigated the mechanism underlying mosaic chromosome aneuploidy in AD and report that FAD mutations in the Alzheimer Amyloid Precursor Protein gene, APP, induce chromosome mis-segregation and aneuploidy in transgenic mice and in transfected cells. Furthermore, adding synthetic Aβ peptide, the pathogenic product of APP, to cultured cells causes rapid and robust chromosome mis-segregation leading to aneuploid, including trisomy 21, daughters, which is prevented by LiCl addition or Ca2+ chelation and is replicated in tau KO cells, implicating GSK-3β, calpain, and Tau-dependent microtubule transport in the aneugenic activity of Aβ. Furthermore, APP KO cells are resistant to the aneugenic activity of Aβ, as they have been shown previously to be resistant to Aβ-induced tau phosphorylation and cell toxicity. These results indicate that Aβ-induced microtubule dysfunction leads to aneuploid neurons and may thereby contribute to the pathogenesis of AD.

INTRODUCTION

Developing early diagnoses and successful treatments for Alzheimer's disease (AD) will be greatly aided by a clear understanding of all steps in the pathogenic pathway that leads to amyloid deposition, neurofibrillary tangle formation, inflammation, and neurodegeneration in the brain. Although most AD is “sporadic,” a large proportion is at least partly “familial” in that patients develop the disease by inheriting a mutant gene or a risk-enhancing genetic polymorphism. Autosomal dominant mutations, accounting for ~5% of AD, have been described in three genes, and their analysis has provided especially important insights into the AD pathogenic pathway (Glenner and Wong, 1984 blue right-pointing triangle; Hardy and Selkoe, 2002 blue right-pointing triangle). One of these genes encodes the amyloid precursor protein (APP) from which the key amyloid component, the Aβ peptide, is derived by proteolysis. Although mutations in the APP gene itself account for <1% of AD, they provided the proof that APP and Aβ are central to the disease process.

Most autosomal dominantly inherited familial Alzheimer's disease (FAD) is caused by mutations in two presenilin genes, most commonly PS-1. The PS proteins must therefore also occupy a key place in the AD pathogenic pathway together with APP and the Aβ peptide. The role of the presenilins in AD pathology was clarified when they were found to form the enzymatic core of the γ-secretase complex that cleaves APP in its transmembrane region and generates the C-terminus of the Aβ peptide (Wolfe, 2003 blue right-pointing triangle).

Several lines of evidence indicate that both sporadic and familiar AD patients, including those carrying APP and PS mutations, are abnormal in one or more aspects of the cell cycle (for reviews, see Obrenovich et al., 2003 blue right-pointing triangle; Potter, 2004 blue right-pointing triangle, 2008 blue right-pointing triangle). For example, Down syndrome (DS) patients, who carry three copies of chromosome 21 in all of their cells due to meiotic chromosome mis-segregation in one of (usually) their mother's germ cells, invariably develop AD-like pathology by the age 30–40 (Olson and Shaw, 1969 blue right-pointing triangle; Glenner and Wong 1984 blue right-pointing triangle; Epstein, 1990 blue right-pointing triangle). This and other findings led us to propose that over a lifetime, defective mitoses lead to the accumulation of aneuploid cells throughout the body, including the brain. When such chromosome mis-segregation generates trisomy 21 cells, the extra copy of the APP gene on chromosome 21 contributes to the development of Alzheimer neuropathology and dementia (Potter, 1991 blue right-pointing triangle). The microtubule (MT) disfunction likely responsible for the aneuploidy in AD patients could also affect other aspects of cell physiology, especially in neurons.

The chromosome mis-segregation/MT disfunction hypothesis of AD makes several easily-testable predictions (Potter, 1991 blue right-pointing triangle). For example, AD patients should be mosaic for trisomy 21, and, indeed, we found trisomy 21 and other aneuploid cells in primary skin fibroblast cultures from patients with both the familial (early age of onset) and sporadic (late age of onset) forms of the disease (Potter et al., 1995 blue right-pointing triangle; Geller and Potter, 1999 blue right-pointing triangle). Trisomy 21 cells have also been observed among peripheral blood lymphocytes, buccal cells, and brain neurons from sporadic AD patients and among lymphocytes of mothers who, at a young age, gave birth to a DS child and are prone themselves to develop AD later in life (Schupf et al., 1994 blue right-pointing triangle; Migliore et al., 1999 blue right-pointing triangle, 2006 blue right-pointing triangle; Yang et al., 2001 blue right-pointing triangle; Mosch et al., 2007 blue right-pointing triangle; Thomas and Fenech, 2008 blue right-pointing triangle; Iourov et al., 2009 blue right-pointing triangle). Conversely, between 1 and 10% trisomy 21 mosaicism has also been found in individuals with otherwise unexplained AD-like dementia in middle age, indicating that even small numbers of trisomy 21 cells can lead to cognitive deficits (Rowe et al., 1989 blue right-pointing triangle; Shapiro et al., 1989 blue right-pointing triangle; Puri et al., 1994 blue right-pointing triangle; Ringman et al., 2008 blue right-pointing triangle).

Advanced AD patients also develop tetraploid neurons (Yang et al., 2001 blue right-pointing triangle; Mosch et al., 2007 blue right-pointing triangle), which may indicate entry into an incomplete cell cycle (Vincent et al., 1996 blue right-pointing triangle; Obrenovich et al., 2003 blue right-pointing triangle; Varvel et al., 2008 blue right-pointing triangle). Through the elegant use of several techniques, Arendt and colleagues found increases in both aneuploid and tetraploid neurons in AD brain, with the ~30% aneuploid cells (between 2n and 4n) being >10 times more common than tetraploid neurons (Mosch et al., 2007 blue right-pointing triangle).

Another prediction of the chromosome mis-segregation/MT disfunction hypothesis for AD is that the very genes that, when mutant, cause familial AD should encode proteins that are involved in the cell cycle and chromosome segregation. Indeed, a polymorphism in the PS-1 gene is associated with both an increased risk of developing AD and of having a Down syndrome child (Wragg et al., 1996 blue right-pointing triangle; Higuchi et al., 1996 blue right-pointing triangle; Petersen et al., 2000 blue right-pointing triangle; Lucarelli et al., 2004 blue right-pointing triangle). Furthermore, immunocytochemical and FRET results have shown that endogenous PS-1 and APP and some of their interacting proteins reside in cell structures involved in mitosis, such as the nuclear membrane, centrosomes, or kinetochores (Zimmermann et al., 1988 blue right-pointing triangle; Li et al., 1997 blue right-pointing triangle; Honda et al., 2000 blue right-pointing triangle; Johnsingh et al., 2000 blue right-pointing triangle; Kimura et al., 2001 blue right-pointing triangle; Tezapsidis et al., 2003 blue right-pointing triangle; Zitnik et al., 2006 blue right-pointing triangle; Nizzari et al., 2007 blue right-pointing triangle) and become hyperphosphorylated during mitosis (Pope et al., 1994 blue right-pointing triangle; Suzuki et al., 1994 blue right-pointing triangle; Preuss et al., 1995 blue right-pointing triangle).

Previously, we used transgenic and knockin mice and transfected cells in culture to test directly the effect of the PS-1 gene on the cell cycle. All assays, tissues, and cells yielded the same results and allowed the conclusion that overexpression or mutation of PS-1 leads to chromosome mis-segregation and aneuploidy, including trisomy 21 (Boeras et al., 2008 blue right-pointing triangle; Potter, 2008 blue right-pointing triangle). Analysis of the PS-1–transfected cells by immunocytochemistry revealed numerous abnormalities in the mitotic spindle apparatii, including improper MT arrays and lagging chromosomes. Finally, dominant negative mutant forms of presenilin failed to induce chromosome mis-segregation, showing that presenilin/γ-secretase is directly involved in the mutant PS-1–induced cell cycle and chromosome segregation defects.

During the course of these studies, we noted that the percentage of cells with abnormal chromosome complements that arose in the PS-1–transfected cultures was often higher than the measured transfection efficiency. This fact strongly suggested that the PS-1 effect on chromosome mis-segregation was not restricted to the PS-1–expressing cells, but also extended to adjacent, nontransfected cells (i.e., was non-cell autonomous) and thus might be induced by a secreted molecule. Coupling this observation to the fact that γ-secretase activity was essential for the PS-1–induced chromosome mis-segregation and to the previous finding that patients carrying FAD mutations in APP also developed trisomy 21 mosaicism led us to hypothesize that secreted Aβ peptide itself might induce cell cycle defects including chromosome mis-segregation (Boeras et al., 2008 blue right-pointing triangle).

In this article we test whether 1) expression of an FAD mutant APP gene in transgenic mice or in transfected cells leads to chromosome mis-segregation, particularly in brain neurons, 2) exposing cells in culture to Aβ peptide itself leads to chromosome mis-segregation, 3) Ca2+ chelation or exposure to LiCl (two treatments that have been shown to obviate Aβ toxicity by inhibition of calpain and GSK-3β, respectively) prevent Aβ from inducing chromosome mis-segregation, and finally whether 4) knocking out the MT associated protein Tau involved in both mitosis and AD also causes chromosome mis-segregation.

MATERIALS AND METHODS

Mice

Transgenic mice expressing human APP with the V717F APP mutation (19–21 months) or knocked out for APP (3 months) and their nontransgenic littermates were used. Tau+/− mice and Tau−/− mice and their nontransgenic Tau+/+ controls were 6–7 mo old (Jackson Labs). All mice used in this study had C57BL/6 background strain.

Primary Cells

Mouse primary splenocytes were prepared for metaphase chromosome analysis and fluorescence in situ hybridization (FISH; Boeras et al., 2008 blue right-pointing triangle). Mouse brains were harvested, the meninges and cerebella were removed, and cells were obtained by triturating brain pieces in ice-cold 1× PBS (Cellgro, Manassas, VA) ~40 times with fire-polished Pasteur pipettes of different pore sizes. The cell suspension was fixed in cold 3:1 anhydrous methanol:acetic acid fixative and kept on ice for at least 30 min. Fixed brain cells were stored at −20°C before any downstream assay was performed.

Cell Line

The hTERT-HME1 cell line is a primary human mammary epithelial cell line that permanently expresses the telomerase reverse transcriptase (Clontech, Palo Alto, CA) and has a stable karyotype (Jiang et al., 1999 blue right-pointing triangle). Cells were maintained in supplemented mammary epithelium basal medium (MEBM, Lonza, Hopkinton, MA) and passaged every 2–3 d according to the supplier's recommendations. All experiments were conducted with the hTERT cells passages 3–6.

Plasmids

Plasmids constructed by inserting an FAD combination mutant NL-APP K595N/M596L (Swedish) and V642I (London) APP gene cDNA into the pcDNA3.1 expression vector or FAD mutant V717I into pAG3 vector were gifts of Dr. Chad Dickey (University of South Florida, Tampa) and Todd Golde (Mayo Clinic, Jacksonville). NucleoBond Plasmid Purification kit (BD Biosciences, San Diego, CA) was used for nucleic acid purification.

Transient Transfections

One day before the transfection, the hTERT cells (1–1.5 × 105 cells/2 ml) were plated in a six-well plate and grown in supplemented MEBM. A FuGene6 (Roche Applied Science, Indianapolis, IN)-DNA complex was prepared according to the manufacturer's recommendations using a ratio of Fugene 6 to DNA of 3 μL:1 μg and was applied to the cells. At 48 h after transfection, cells were either harvested immediately for FISH or treated with 37 ng/ml colcemid for 6–7 h before the harvest, collected, fixed, and scored for aneuploidy in metaphase chromosome spreads.

Peptides and Salts

Synthetic Aβ1-40, Aβ1-42, and Aβ42-1 from either BioSource International (Camarillo, CA) or American Peptide Company (Sunnyvale, CA) were resuspended in sterile HPLC water at room temperature, aliquoted, and stored at −80°C before use. Other control peptides were custom made by either Sigma Genosys (St. Louis, MO) or Bio-Synthesis (Lewisville, TX), and were designed by random scrambling of the Aβ12-28 or Aβ1-42 sequence (NH2-VHHQKLVFFAEDVGSNK-OH and NH2-ADFVGSVINIGKLELKMVGQVGVHGIAEVHFDYSFADHEARG-OH), respectively. Similarly, LiCl (Fisher Scientific, Pittsburgh, PA) and BAPTA (Invitrogen, Carlsbad, CA) salts were resuspended in HPLC water.

In Vitro Incubation of the Primary Cells and Cell Lines with Aβ Peptides, BAPTA, and LiCl

For each experiment, a fresh aliquot of the various Aβ peptides, BAPTA, or LiCl was used and thawed on ice to avoid repeated thaw-freeze cycles and possible changes in the structure of the molecules. Primary mouse splenocytes were stimulated to divide in concanavalin A (Con-A) containing media for 44 h in either 100-mm dishes (7.5–8 × 105 cells/10 ml growth media) or in six-well plates (4–5 × 105 cells/3 ml growth media). The cells were treated with Aβ peptide for 44–48 h and prepared according to established cytogenetic procedures described below. In coincubation experiments, the Tau+/+ splenocytes were pretreated with either 1 μM of BAPTA for 3 min before the peptides were added or with 2.5 mM of LiCl for the last 7 h of Aβ peptide incubation.

Similarly, 24 h before Aβ treatment, a low passage of the hTERT-HME1 cells was seeded in either six-well dish (1–1.5 × 105 cells/well) or in a 100-mm culture dish (4–5 × 105 cells/55 cm2). For the last 10–12 h of peptide exposure, the cells were treated with 33 ng/ml colcemid, harvested, fixed, and scored for aneuploidy by either karyotype analysis or FISH.

Metaphase Chromosome Analysis

After colcemid treatment, cells were harvested according to standard cytogenetic methods as described (Boeras et al., 2008 blue right-pointing triangle). Genus 2.81 software (Applied Imaging, San Jose, CA) and the Metafer 3.31 Slide Scanning System (MetaSystems, Altslussheim, Germany) with Isis 5.2 (ver. 2007; MetaSystems) was used for metaphase spreads capture and chromosome analysis. At least 80 mouse splenocyte metaphases and 45 hTERT-HME1 cells metaphase spreads were analyzed per each sample.

FISH

A bacterial artificial chromosome (BAC) containing a mouse chromosome 16–specific sequence (a gift from Dr. Bruce Lamb at Case Western Reserve University) was labeled by nick translation (Abbot, Vysis, Downer's Grove, IL) as described elsewhere (Kulnane et al., 2002 blue right-pointing triangle; Boeras et al., 2008 blue right-pointing triangle) with modification. Specifically, 1 mM of either Spectrum Green dUTP (Abbot, Vysis) or Spectrum Orange dUTP (Enzo Life Science, Bedford, MA) was used to label 1 μg of BAC DNA. The preincubated (37°C over night) BAC probe was used for FISH of mouse primary cells. Labeled BAC probe and mouse brain cells dehydrated in ethanol solutions (70, 80, and 90%) were codenatured at 74°C for 4 min and hybridized at 37°C for 22 h in the HyBrite (Vysis) hybridization chamber followed by additional 20–22 h of hybridization at 38°C. Excess probe was removed by three consecutive washes in 0.4× SSC at 37°C for 4 min, 2× SSC/0.1% NP40 at room temperature for 3 min, and 4× SSC/0.1% NP40 for 2 min. DAPI II (Abbot, Vysis) or Vectashield (Vector Laboratories, Burlingame, CA) counterstain was used to stain nuclear DNA. Mouse spleen cells were subject to similar in situ protocol except they required shorter hybridization time and less thorough washing.

Interphase FISH of hTERT-HME1 cells was performed using the LSI TEL/AML1 ES Dual Color Translocation Probe (Abbot, Vysis). Hybridizations were done according to Vysis recommendations for LSI probes in the HyBrite hybridization chamber (Vysis) and counterstained with DAPI II.

Image Acquisition and Analysis

Hybridization signals were scored according to Vysis guidelines using either a Nikon Eclipse E1000 microscope (Melville, NY) with a 4912 CCIR high-performance Cohu CCD camera (San Diego, CA) and Genus 2.81 software for image processing (Applied Imaging, San Jose, CA) or a Zeiss Imager.M1 Axio microscope with a CV-M4+CL high-resolution camera (Thornwood, NY). In interphase cells, only bright and compact signals were counted separately for each probe using DAPI, FITC, and TRITC Nikon filter cubes with a Nikon Eclipse E1000 fluorescence microscope and Genus 2.81 software or under 49 DAPI, 38 HE Green Fluorescent, and 43HE Red Zeiss filters with a Zeiss Imager.M1 Axio fluorescence microscope. The Abbott/Vysis (http://www.abbottmolecular.com/DualColorEnumeration_36752.aspx) guidelines were followed meticulously. Particularly important is that, as required, closely adjacent double spots, double spots linked by a light fluorescent thread, and defused signals were counted as only single spots (i.e., one chromosome) and not two spots (i.e., two chromosomes).

Antibodies

For immunocytochemistry and immunofluorescence we used anti-α-tubulin (Sigma, clone B-5-1-2), 1:500; Ms X Neuronal Nuclei (NeuN) AlexaFluor 488 (Millipore, Bedford, MA), 1:100; and Alexa Flour 488 rabbit α-mouse IgG (Invitrogen, Molecular Probes, Eugene, OR), 1:1000.

Immunocytochemistry after FISH

Immediately after hybridization, brain cells were incubated in 1× PBS for 10 min. The slides were blocked in 10% goat serum/0.1% Triton X-100 1× PBS solution for 1 h. Conjugated Ms X Neuronal Nuclei AlexaFluor 488 (Millipore) was diluted 1:100 in 1% BSA/0.1% Triton X-100 1× PBS and applied to the slides overnight to stain for neurons. After final washes, coverslips were mounted onto slides with DAPI II (Abbot, Vysis).

Statistical Analysis

Paired Student's t test was used to compare the aneuploidy induced by different peptide and inhibitor treatments and plasmid transfections in multiple experiments and to compare the levels of aneuploidy in mouse primary cell line with and without a human FAD transgene. At least 10–12 mice were analyzed for each graph and five to seven transfections/treatments of each plasmid/peptide were scored for aneuploidy.

RESULTS

Expression of FAD Mutant APP Causes Chromosome Mis-Segregation in Transgenic Mice

To understand the mechanism by which chromosome aneuploidy arises in AD, we asked whether the expression of FAD-mutant APP disrupts the cell cycle and causes chromosome mis-segregation. First, metaphase chromosome analysis was used to compare the chromosome complement of FAD-APP–expressing transgenic mice (PDAPP) and age-matched normal mice. Primary splenocytes were chosen for this analysis because they can be induced to divide in culture, a requirement for metaphase analysis, and the transgene promoter is active in the spleen. The dividing cells were arrested at metaphase by colcemid treatment and the chromosomes stained and counted. The data showed twice the level of aneuploidy (i.e., 25% of cells with both less or more than the normal mouse complement of 40 chromosomes) in the FAD-APP animals compared with nontransgenic animals (Figure 1A). There was no increase in the number of tetraploid/polyploid cells (not shown).

Figure 1.
Chromosome aneuploidy induced in transgenic mouse splenocytes carrying an AD mutant APP transgene (V717F). (A) Karyotype analysis of nontransgenic (NON) and transgenic APP+/− mice showed significantly higher levels of aneuploidy in the cells harboring ...

FISH allows aneuploidy for particular chromosomes to be assessed at all phases of the cell cycle. A BAC carrying a 300-kb fragment of mouse chromosome 16 (Kulnane et al., 2002 blue right-pointing triangle) was labeled with spectrum green dUTP (Abbott) by nick translation and used as a hybridization probe to tag chromosome 16 in transgenic and normal mouse splenocytes (Figure 1B). Expression of the mutant APP transgene induced a many-fold increase in both trisomy and monosomy 16 (Figure 1, C and D).

Chromosome Aneuploidy in Neurons from FAD-APP Transgenic Mice

The effect of an FAD mutation (V717F) in the APP gene on the chromosome complement of brain cells was examined using DNA FISH, which can be used to count chromosomes in both the nondividing neurons and cycling cells such as glia. Whole brains from PS-1 transgenic and nontransgenic mice were processed to yield suspensions of mixed primary cells. The cells were fixed to slides and hybridized with the mouse chromosome 16 BAC probe labeled with Orange-dUTP. The hybridization efficiency was ~90%, with most cells being disomic, i.e., exhibiting two signals (Figure 2A). By colabeling with Neu-N antibody, we found that ~6.5% of neurons in APP transgenic mice were trisomic for chromosome 16 compared with 1.5% of neurons in nontrangenic mice brain (Figure 2B). There was no increase in aneuploidy in nonneuronal cells (Neu-N negative; Figure 2C). These robust results with one chromosome probe indicate that even more tgAPP neurons are likely to be aneuploid, just as 5% trisomy 16 among spleen cells correlated to 25% total aneuploidy in metaphase spreads (which cannot be generated for postmitotic neurons).

Figure 2.
Trisomy 16 induced in neurons of mice carrying a mutant APP transgene. Quantitative FISH analysis of resuspended cells from the whole brain of FAD mutant V717F mice costained with the NeuN antibody (A) revealed significantly higher levels of trisomy 16 ...

Small numbers of tetraploid neurons have been reported in AD humans and mice and interpreted as being due to adult neurons reentering the cell cycle and completing DNA replication, but failing to complete cell division (Yang et al., 2001 blue right-pointing triangle, 2006 blue right-pointing triangle; Obrenovich et al., 2003 blue right-pointing triangle; Mosch et al., 2007 blue right-pointing triangle; Zhu et al., 2008 blue right-pointing triangle). We observed no increase in tetrasomy 16 in disaggregated cells from APP mice brains compared with nontransgenic brains (Figure 2D); see also Iourov et al. (2009) blue right-pointing triangle, who also report finding human AD cortical neurons with trisomy 21 but very few neuronal or nonneuronal cells showing tetrasomy or polyploidy.

These and previous results show that expression of FAD mutant forms of either APP or PS-1 in transgenic mouse models of AD disrupts normal mitosis, leading to chromosome mis-segregation and the development of aneuploid cells in both the brain and the periphery. The presence of aneuploid neurons in both APP and PS-1 transgenic mice indicates that both classes of FAD-causing mutations cause cell cycle and chromosome mis-segregation defects in neuronal precursor cells.

Expression of FAD Mutant APP Causes Chromosome Mis-Segregation and Aneuploidy in Transfected Cells

To confirm that the aneuploidy observed in FAD-APP transgenic mice was caused directly by the expression of the mutated gene, we asked whether mutant APP could also induce aneuploidy after transient expression in mammalian cells in culture. To assure a low background level of cell cycle defects such as aneuploidy, we used as a transfection recipient the hTERT-HME1 cell line, a (karyotypically stable) primary human cell line transfected with a telomerase reverse transcriptase gene to confer immortality (Jiang et al., 1999 blue right-pointing triangle; Morales et al., 1999 blue right-pointing triangle).

Parallel cultures of hTERT cells were transiently transfected with plasmids expressing a human APP gene carrying both the NL-APP K595N/M596L (Swedish) and V642I (London) mutations or the V717I APP mutation. The empty vectors served as controls. FISH with a double-labeled probe showed that expression of mutant APP induced chromosome mis-segregation and the development of aneuploidy for both chromosome 21 and 12 (Figure 3, A–C), but did not induce an increase in tetraploid cells (Figure 3D). Together, these results show that the aneugenic activity of mutant APP expression likely affects all chromosomes randomly and therefore probably alters an essential aspect of normal mitosis. Mutant APP did not induce aborted cell cycles in which DNA replication occurs without a subsequent cell division in these short-term experiments.

Figure 3.
Chromosome aneuploidy induced in cells expressing either NL-APP K595N/M596L and V642I or V717F mutant APP. hTERT cells were transfected with expression vectors for the mutant human APP genes with the empty vectors pcDNA3 or pAG3 serving as control. The ...

AD-causing Peptides Induce Chromosome Mis-Segregation and Aneuploidy

Because overexpression or mutation in either PS-1 or APP cause cell cycle defects and chromosome mis-segregation, we hypothesized that the product of APP cleavage by PS-1—the Aβ peptide itself—might be the effector molecule responsible for disrupting the mitotic spindle (Boeras et al., 2008 blue right-pointing triangle). We tested this hypothesis by directly exposing cells in culture to Aβ and various control peptides for 48 h and counting chromosomes by karyotype analysis and by FISH. Both Aβ1-40 and Aβ1-42 induced significant chromosome mis-segregation and aneuploidy in cultured hTERT cells within 48 h whereas the Aβ 42-1 reverse peptide, the Aβ1-42 scrambled peptide and the Aβ12-28 scrambled peptide had no significant effect on untreated cells (Figure 4A,B), a result confirmed by FISH analysis of chromosomes 21 and 12 (Figure 5, A–C).

Figure 4.
High levels of total aneuploidy induced in hTERT cells by either Aβ40 or Aβ42. In the series of seven experiments, metaphase karyotypes of peptide-treated hTERT cells were examined after 48 h exposure to Aβ and control peptides ...
Figure 5.
Specific chromosome aneuploidy, including trisomy 21 and trisomy 12 induced by exposure of hTERT cells to Aβ peptide. Quantitative FISH analysis with a dual color probe detecting both chromosome 21 (SpectrumOrange) and 12 (SpectrumGreen) revealed ...

Mechanism of Aβ-induced Chromosome Mis-Segregation: Roles for Tau and APP

To investigate the mechanism by which Aβ, and by implication mutant APP and PS, cause cells to undergo chromosome mis-segregation and yield aneuploid daughters, we assumed that its aneugenic function was related to the peptide's other toxic activities, especially those related to MT-based transport, which is, of course, required for proper chromosome segregation. The data of Figure 6, A and B, show that pretreating normal splenocytes with BAPTA, which chelates extracellular Ca2+ and thus inhibits, for instance, calpain activation, or with LiCl, which inhibits GSK-3β, prevents Aβ from inducing chromosome mis-segregation. BAPTA and LiCl have previously been shown to inhibit Aβ toxicity (Lee et al., 2000 blue right-pointing triangle; Takashima 2006 blue right-pointing triangle).

Figure 6.
Pretreating normal splenocytes for 3 min with 1 mM BAPTA, a chelator of extracellular Ca2+, showed a reduction in Aβ 1-42–induced trisomy 16 (A). Similarly, the coincubation with 1 μM of Aβ 1-42 for 48 h and 2.5 mM of LiCl, ...

Numerous studies, both in vitro and in vivo, have shown that Aβ (and FAD mutant PS-1 and APP) induces increased phosphorylation of the MT-associated protein Tau, the main component of the intraneuronal paired helical filaments and neurofibrillary tangles of AD (Lee 1996 blue right-pointing triangle; Pigino et al., 2001 blue right-pointing triangle; Small and Duff, 2008 blue right-pointing triangle). Indeed, the toxicity of Aβ depends on the presence of Tau (Rapoport et al., 2002 blue right-pointing triangle; Roberson et al., 2007 blue right-pointing triangle). Interestingly, activated calpain cleaves Tau, inactivating it, and yielding a toxic fragment, and GSK-3β phosphorylates Tau at AD-PHF-relevant sites and is itself involved in chromosome segregation (Lee 1996 blue right-pointing triangle; Wakefield et al., 2003 blue right-pointing triangle; Park and Ferreira, 2005 blue right-pointing triangle). We therefore investigated the role of Tau in chromosome segregation. Spenocytes were prepared from normal, Tau+/−, and full Tau−/− knockout mice, allowed to grow for 48 h in the presence and absence of Aβ, and analyzed for chromosome aneuploidy. As shown in Figure 7, A and B, knocking out one, or even more effective, both copies of Tau led to increased aneuploidy. Addition of Aβ only induced a clear increase in chromosome mis-segregation in normal cells, indicating that the aneugenic effect of Aβ requires and disrupts normal, Tau-stabilized, MT function.

Figure 7.
Knocking out Tau replicates/replaces ability of Aβ to induce chromosome mis-segregation. Spleen cells from normal (WT) and Tau+/− and Tau−/− mice were cultured ± Aβ1-42 and Aβ1-40 for 48 h, and the ...

Finally, Aβ-induced cellular toxicity has been shown to require the presence of full-length APP as a receptor on the surface of the target cell, perhaps to aid in the uptake of exogenous Aβ or to undergo induced endocytosis and processing to generate intracellular Aβ (Lorenzo et al., 2000 blue right-pointing triangle; Shaked et al., 2006 blue right-pointing triangle; Sola Vigo et al., 2009 blue right-pointing triangle). We have tested whether the effect of Aβ on chromosome segregation in treated cells similarly requires interaction with endogenous APP. Addition of Aβ 40 or 42 to APP−/− spleen cells fails to induce chromosome mis-segregation and aneuploidy over background, (Figure 8). This result further indicates that Aβ-induced chromosome mis-segregation is part of, and likely contributes to, the peptide's toxic action.

Figure 8.
Knocking out APP in the target cells prevents Aβ from inducing further chromosome mis-segregation and aneuploidy. Spleen cells from APP−/− mice were cultured ± Aβ1-42, Aβ1-40, and scrambled Aβ1-42 ...

DISCUSSION

The preponderance of the data—from pathology, from genetics, from biochemistry, from cell biology, and from the mouse models designed to mimic the human disease—point to the Aβ peptide as playing a central role in the pathogenic pathway to AD (Hardy and Selkoe, 2002 blue right-pointing triangle). For example, mutations in APP or PS affect either the sequence of Aβ, or the cleavage of the APP protein, so as to generate forms of Aβ that, under the essential catalytic influence of inflammatory proteins, specifically apolipoprotein E and antichymotrypsin, are more prone to first oligomerize and then polymerize and aggregate into the toxic amyloid deposits of AD (Wolfe, 2003 blue right-pointing triangle; Potter et al., 2001 blue right-pointing triangle). Both in vitro and in vivo studies have shown that oligomerized and/or polymerized Aβ is toxic to neurons (Yankner et al., 1989 blue right-pointing triangle; Ma et al., 1994 blue right-pointing triangle, 1996 blue right-pointing triangle; Wisniewski et al., 1994 blue right-pointing triangle; Kayed et al., 2003 blue right-pointing triangle; Chromy et al., 2003 blue right-pointing triangle; Townsend et al., 2006 blue right-pointing triangle).

The importance of Aβ is also supported by the fact that DS patients, whose cells carry three copies of chromosome 21 (and of the APP gene) in all of their cells due to chromosome mis-segregation during meiosis produce increased levels of Aβ peptide and invariably develop AD pathology at an early age (Olson and Shaw 1969 blue right-pointing triangle; Epstein, 1990 blue right-pointing triangle, Potter, 1991 blue right-pointing triangle, 2008 blue right-pointing triangle). Even mosaic DS individuals, with only a small proportion of trisomy 21 cells, develop early dementia. Furthermore, FAD can be caused by a duplication of one APP gene on one chromosome, confirming that a mere 50% overproduction of APP/Aβ is sufficient to cause very early AD in the context of an otherwise normal human brain (Sleegers et al., 2006 blue right-pointing triangle; Rovelet-Lecrux et al., 2006 blue right-pointing triangle).

The data of this article, together with our earlier results, support the hypothesis that a potentially important step in the pathogenic pathway by which Aβ overproduction leads to AD is Aβ's interference with the cytoskeleton, leading to chromosome mis-segregation during mitosis (Potter, 1991 blue right-pointing triangle, 2008 blue right-pointing triangle; see also Rassoulzadegan et al., 1998 blue right-pointing triangle). More specifically, the Aβ product of the PS γ-secretase enzyme acting on APP, at least in part by inactivating Tau, may contribute to AD by inducing the mis-segregation of chromosomes and the development of aneuploid, including trisomy 21, cells. Knocking out the Tau gene also causes chromosome mis-segregation and aneuploidy.

The mechanism by which Aβ induces cell cycle abnormalities evidently involves activation of GSK-3β and the influx of Ca2+, because blocking either of these two activities restores chromosome segregation to normal. In addition, Tau-stabilized MTs are a necessary substrate for the aneugenic activity of Aβ. These findings are linked, for Ca2+ is necessary for the Aβ-induced cleavage and inactivation of Tau and GSK-3β for Aβ-induced phosphorylation and inactivation of Tau and both for Aβ toxicity (Park and Ferreira, 2005 blue right-pointing triangle; Takashima, 2006 blue right-pointing triangle). Ca2+ is also necessary for activation of kinesin-like MT motors through Ca2+-binding regulatory proteins (Vinogradova et al., 2009 blue right-pointing triangle; Wang and Schwartz, 2009 blue right-pointing triangle). Indeed we consider it likely that Aβ directly damages the MT system such that Tau disconnects from MTs, becomes prone to cleavage, and phosphorylation, further destabilizing MTs.

Aβ's ability to inhibit MT function and cause chromosome mis-segregation will have major deleterious effects, particularly on neurons and on their precursors. Because neurogenesis occurs throughout life, especially following neuronal loss (Zhao et al., 2008 blue right-pointing triangle), Aβ-induced chromosome mis-segregation will yield aneuploid, defective, neuronal precursor cells and should thus inhibit the production of fully functional replacement neurons, as found in FAD-tg mice and AD patients. For instance the trisomy 21 cells that accumulate in AD patients overexpress APP and Aβ, which imbalance should promote the disease as it does in mosaic trisomy 21 or APP-duplication individuals who are born normal but later develop early AD pathology and dementia. Indeed, trisomy 21 neurons are prone to apoptosis, PS-1 mutation or overexpression (and thus increased Aβ production) induces cell cycle defects in cultured cells, and mice harboring an FAD mutant human APP or PS-1 gene have reduced neurogenesis and other cell cycle defects (Wolozin et al., 1996 blue right-pointing triangle; Busciglio and Yankner, 1997 blue right-pointing triangle; Janicki and Monteiro, 1999 blue right-pointing triangle; Chui et al., 1999 blue right-pointing triangle; Feng et al., 2001 blue right-pointing triangle; Wen et al., 2004 blue right-pointing triangle; Wang et al., 2004 blue right-pointing triangle; Chevallier et al., 2005 blue right-pointing triangle; Boeras et al., 2008 blue right-pointing triangle; Zhang et al., 2007 blue right-pointing triangle;Verret et al., 2007 blue right-pointing triangle; Boeras et al., 2008 blue right-pointing triangle; Varvel et al., 2008 blue right-pointing triangle). Any dividing precursor or mature cell, in culture or in vivo, which cannot undergo proper chromosome segregation will produce defective progeny prone to apoptosis.

Aβ damage to MT function will also lead to intracellular trafficking defects that will particularly affect mature neurons (see for example Stokin et al., 2005 blue right-pointing triangle; Lazarov et al., 2007 blue right-pointing triangle). Motor proteins needed for proper interaction of MTs with kinetochores or other cargo require Ca2+, and stability of MTs in neurons is reduced by Ca2+-dependent cleavage of Tau or by GSK-3β-dependent phosphorylation of Tau, both of which are induced by Aβ, as discussed above.

A direct connection between P-Tau and chromosome mis-segregation is reinforced by the recent finding that the P301L mutation in Tau that causes frontal temporal dementia (FTD) also causes Tau hyperphosphorylation, chromosome mis-segregation, and aneuploidy (Rossi et al., 2008 blue right-pointing triangle). Just as we showed for AD, the finding of FTD-related chromosome defects confirms the presence of Tau, MT disfunction, and chromosome mis-segregation on the causal path to neurodegeneration in these two related disorders. Interestingly, Pin1, which modulates Tau phosphorylation, also causes chromosome mis-segregation, aneuploidy, and oncogenic transformation in transfected cells (Suizu et al., 2006 blue right-pointing triangle).

The fact that both AD and FTD are associated with advancing age and that aging leads to increased aneuploidy even in normal neuronal precursors and other cells (Geller and Potter, 1999 blue right-pointing triangle; Rehen et al., 2001 blue right-pointing triangle; Thomas and Fenech, 2008 blue right-pointing triangle; Granic and Potter, unpublished data), further supports the hypothesis that slow development of such aneuploidy contributes to age-related neurodegenerative disease (Potter, 1991 blue right-pointing triangle; Li et al., 1997 blue right-pointing triangle). Indeed two other common age-promoted diseases, cancer and cardiovascular disease, are also characterized and likely promoted by chromosome mis-segregation and aneuploidy (Duesberg, 1999 blue right-pointing triangle; Potter et al., 2008 blue right-pointing triangle).

In sum, the data of this article and previous results show that the Aβ peptide found at increased levels in both sporadic and familial AD interferes with mitosis and chromosome segregation, thus leading to trisomy 21 mosaicism and other chromosome aneuploidy. The implication of the results is that MT disruption leading to cell cycle, chromosome mis-segregation, and other cytoskeletal defects in neuronal precursor cells may underlie many of the neurotoxic aspects of AD. The findings also suggests that novel approaches to diagnosis and treatment directed at detecting and preventing disruption of MT function and/or the development of chromosome aneuploidy with age may be successful against AD and possibly other age-associated disorders.

ACKNOWLEDGEMENTS

Mutant APP plasmids were provided by Chad Dickey and Todd Golde, and aged C57BL-6 by Jun Tan (University of South Florida). The chromosome 16 BAC was kindly provided by Bruce Lamb. This work was supported by the Byrd Alzheimer's Institute, the Eric Pfeiffer Chair for Research on Alzheimer's Disease, the Alzheimer's Association, and the Nation Institute on Aging Grant AG25711.

Footnotes

This article was published online ahead of print in MBC in Press (http://www.molbiolcell.org/cgi/doi/10.1091/mbc.E09-10-0850) on December 23, 2009.

REFERENCES

  • Boeras D. I., Granic A., Crespo N. C., Rojiani A. M., Potter H. Alzheimer's presenilin 1 causes chromosome missegregation and aneuploidy. Neurobiol. Aging. 2008;29:3119–3128. [PMC free article] [PubMed]
  • Busciglio J., Yankner B. A. Apoptosis and increased generation of reactive oxygen species in Down's syndrome neurons in vitro. Nature. 1997;378:776–779. [PubMed]
  • Chevallier N. L., Soriano S., Kang D. E., Masliah E., Hu G., Koo E. H. Perturbed neurogenesis in the adult hippocampus associated with presenilin-1 A246E mutation. Am. J. Pathol. 2005;167:151–159. [PubMed]
  • Chromy B. A., et al. Self-assembly of Abeta(1-42) into globular neurotoxins. Biochemistry. 2003;42:12749–12760. [PubMed]
  • Chui D. H., et al. Transgenic mice with Alzheimer presenilin 1 mutations show accelerated neurodegeneration without amyloid plaque formation. Nat. Med. 1999;5:560–564. [PubMed]
  • Duesberg P. Are centrosomes or aneuploidy the key to cancer? Science. 1999;284:2091–2092. [PubMed]
  • Epstein C. J. The consequences of chromosome imbalance. Am. J. Med. Genet. Suppl. 1990;7:31–37. [PubMed]
  • Feng R., et al. Deficient neurogenesis in forebrain-specific presenilin-1 knockout mice is associated with reduced clearance of hippocampal memory traces. Neuron. 2001;32:911–926. [PubMed]
  • Geller L. N., Potter H. Chromosome mis-segregation and trisomy 21 in Alzheimer's disease. Neurobiol. Dis. 1999;6:167–179. [PubMed]
  • Glenner G. G., Wong C. W. Alzheimer's disease and Down's syndrome: sharing of a unique cerebrovascular amyloid fibril protein. Biochem. Biophys. Res. Commun. 1984;122:1131–1135. [PubMed]
  • Hardy J., Selkoe D. J. The amyloid hypothesis of Alzheimer's disease: progress and problems on the road to therapeutics. Science. 2002;297:353–356. [PubMed]
  • Higuchi S., Muramatsu T., Matsushita S., Arai H., Sasaki H. Presenilin-1 polymorphism and Alzheimer's disease. Lancet. 1996;347:1186. [PubMed]
  • Honda T., Nihonmatsu N., Yasutake K., Ohtake A., Sato K., Tanaka S., Murayama O., Murayama M., Takashima A. Familial Alzheimer's disease-associated mutations block translocation of full-length presenilin 1 to the nuclear envelope. Neurosci. Res. 2000;37:101–111. [PubMed]
  • Iourov I. Y., Vorsanova S. G., Liehr T., Yurov Y. B. Aneuploidy in the normal, Alzheimer's disease and ataxia-telangiectasia brain: differential expression and pathological meaning. Neurobiol. Disease. 2009 [PubMed]
  • Jiang X. R., et al. Telomerase expression in human somatic cells does not induce changes associated with a transformed phenotype. Nat. Genet. 1999;21:111–114. [PubMed]
  • Janicki S. M., Monteiro M. J. Presenilin overexpression arrests cells in the G1 phase of the cell cycle. Arrest potentiated by the Alzheimer's disease PS2(N141I)mutant. Am. J. Pathol. 1999;155:135–144. [PubMed]
  • Johnsingh A. A., Johnston J. M., Merz G., Xu J., Kotula L., Jacobsen J. S., Tezapsidis N. Altered binding of mutated presenilin with cytoskeleton-interacting proteins. FEBS Lett. 2000;465:53–58. [PubMed]
  • Kayed R., Head E., Thompson J. L., McIntire T. M., Milton S. C., Cotman C. W., Glabe C. G. Common structure of soluble amyloid oligomers implies common mechanism of pathogenesis. Science. 2003;300:486–489. [PubMed]
  • Kimura N., Nakamura S. I., Honda T., Takashima A., Nakayama H., Ono F., Sakakibara I., Doi K., Kawamura S., Yoshikawa Y. Age-related changes in the localization of presenilin-1 in cynomolgus monkey brain. Brain Res. 2001;922:30–41. [PubMed]
  • Kulnane L. S., Lehman E. J., Hock B. J., Tsuchiya K. D., Lamb B. T. Rapid and efficient detection of transgene homozygosity by FISH of mouse fibroblasts. Mamm. Genome. 2002;13:223–226. [PubMed]
  • Lazarov O., Morfini G. A., Pigino G., Gadadhar A., Chen X., Robinson J., Ho H., Brady S. T., Sisodia S. S. Impairments in fast axonal transport and motor neuron deficits in transgenic mice expressing familial Alzheimer's disease-linked mutant presenilin 1. J. Neurosci. 2007;27:7011–7020. [PMC free article] [PubMed]
  • Lee V. M. Regulation of tau phosphorylation in Alzheimer's disease. Ann. NY Acad. Sci. 1996;777:107–113. [PubMed]
  • Lee M. S., Kwon Y. T., Li M., Peng J., Friedlander R. M., Tsai L. H. Neurotoxicity induces cleavage of p35 to p25 by calpain. Nature. 2000;405:360–364. [PubMed]
  • Li J., Xu M., Zhou H., Ma J., Potter H. Alzheimer presenilins in the nuclear membrane, interphase kinetochores, and centrosomes suggest a role in chromosome segregation. Cell. 1997;90:917–927. [PubMed]
  • Lorenzo A., Yuan M., Zhang Z., Paganetti P. A., Sturchler-Pierrat C., Staufenbiel M., Mautini J., Vigo F. S., Sommer B., Yankner B. A. Amyloid beta interacts with the amyloid precursor protein: a potential toxic mechanism in Alzheimer's disease. Nat. Neurosci. 2000;3:460–464. [PubMed]
  • Lucarelli P., Piciullo A., Palmarino M., Verdecchia M., Saccucci P., Arpino C., Curatolo P. Association between presenilin-1-48C/T polymorphism and Down's syndrome. Neurosci. Lett. 2004;367:88–91. [PubMed]
  • Ma J., Yee A., Brewer H. B., Das S., Potter H. The Alzheimer amyloid-associated proteins αλπηα-1antichymotrypsin and apolipoprotein E promote the assembly of the Alzheimer ß-protein into filaments. Nature. 1994;372:92–94. [PubMed]
  • Ma J., Brewer H. B., Jr, Potter H. Alzheimer A beta neurotoxicity: promotion by antichymotrypsin, ApoE4; inhibition by A beta-related peptides. Neurobiol. Aging. 1996;17:773–780. [PubMed]
  • Migliore L., Boni G., Bernardini R., Trippi F., Colognato R., Fontana I., Coppede F., Sbrana I. Susceptibility to chromosome malsegregation in lymphocytes of women who had a Down syndrome child in young age. Neurobiol. Aging. 2006;27:710–716. [PubMed]
  • Migliore L., Botto N., Scarpato R., Petrozzi L., Cipriani G., Bonuccelli U. Preferential occurrence of chromosome 21 malsegregation in peripheral blood lymphocytes of Alzheimer's disease patients. Cytogenet. Cell Genet. 1999;87:41–46. [PubMed]
  • Morales C. P., Holt S. E., Ouellette M., Kaur K. J., Yan Y., Wilson K. S., White M. A., Wright W. E., Shay J. W. Absence of cancer-associated changes in human fibroblasts immortalized with telomerase. Nat. Genet. 1999;21:115–118. [PubMed]
  • Mosch B., Morawski M., Mittag A., Lenz D., Tarnok A., Arendt T. Aneuploidy and DNA replication in the normal human brain and Alzheimer's disease. J. Neurosci. 2007;27:6859–6867. [PubMed]
  • Nizzari M., et al. Amyloid precursor protein and presenilin1 interact with the adaptor GRB2 and modulate ERK 1,2 signaling. J. Biol. Chem. 2007;282:13833–13844. [PubMed]
  • Obrenovich M. E., Raina A. K., Ogawa O., Atwood C. S., Morelli L., Smith M. A. Alzheimer disease—a new beginning, or a final exit? In: Copani A., Nicoletti F., editors. Cell Cycle Mechanisms and Neuronal Cell Death. Austin, TX: Landes Bioscience; 2003. pp. 79–93.
  • Olson M. I., Shaw C. M. Presenile dementia and Alzheimer's disease in mongolism. Brain. 1969;92:147–156. [PubMed]
  • Park S.-Y., Ferreira A. The generation of a 17 kDa neurotoxic fragment: an alternative mechanism by which tau mediates β-amyloid-induced neurodegeneration. J. Neurosci. 2005;25:5365–5375. [PMC free article] [PubMed]
  • Petersen M. B., Karadima G., Samaritaki M., Avramopoulos D., Vassilopoulos D., Mikkelsen M. Association between presenilin-1 polymorphism and maternal meiosis II errors in Down syndrome. Am. J. Med. Genet. 2000;93:366–372. [PubMed]
  • Pigino G., Pelsman A., Mori H., Busciglio J. Presenilin-1 mutations reduce cytoskeletal association, deregulate neurite growth, and potentiate neuronal dystrophy and tau phosphorylation. J. Neurosci. 2001;21:834–842. [PubMed]
  • Potter H. Review and hypothesis: Alzheimer disease and Down syndrome-chromosome 21 nondisjunction may underlie both disorders. Am. J. Hum. Genet. 1991;48:1192–1200. [PubMed]
  • Potter H. Cell cycle and chromosome segregation defects in Alzheimer's disease. In: Copani A., Nicoletti F., editors. Cell Cycle Mechanisms and Neuronal Cell Death. Austin, TX: Landes Bioscience; 2004. pp. 55–78.
  • Potter H. Down syndrome and Alzheimer's disease: two sides of the same coin. Future Neurol. 2008;3:29–37.
  • Potter H., Granic A., Boeras D., Padmanabhan J. Alzheimer's disease effectors, Aβ peptide and LDL cholesterol induce chromosome mis-segregation and anuploidy, including trisomy 21. Society for Neuroscience Meeting Abstract. 2008;611:4.
  • Potter H., Ma J., Das S., Geller L. N., Benjamin M., Kayyali U. S., Dressler D. Beyond β-protein: new steps in the pathogenic pathway to Alzheimer's disease. In: Iqbal K., Mortimer J. A., Winblad B., Wisniewski H. M., editors. Research Advances in Alzheimer's Disease and Related Disorders. New York: John Wiley & Sons; 1995. pp. 643–654.
  • Potter H., Wefes I. M., Nilsson L.N.G. The inflammation-induced pathological chaperones ACT and apoE are necessary catalysts of Alzheimer amyloid formation. Neurobiol. Aging. 2001;22:923–930. [PubMed]
  • Pope W. B., Lambert M. P., Leypold B., Seupaul R., Sletten L., Krafft G., Klein W. L. Microtubule-associated protein tau is hyperphosphorylated during mitosis in the human neuroblastoma cell line SH-SY5Y. Exper. Neurol. 1994;126:185–194. [PubMed]
  • Preuss U., Döring F., Illenberger S., Mandelkow E.-M. Cell cycle-dependent phosphorylation and microtubule binding of tau protein stably transfected in Chinese hamster ovary cells. Mol. Biol. Cell. 1995;6:1397–1410. [PMC free article] [PubMed]
  • Puri B. K., Zhang Z., Singh I. SPECT in adult mosaic Down's syndrome with early dementia. Clin. Nucl. Med. 1994;19:989–991. [PubMed]
  • Rapoport M., Dawson H. N., Binder L. I., Vitek M. P., Ferreira A. Tau is essential to beta-amyloid-induced neurotoxicity. Proc. Natl. Acad. Sci. USA. 2002;99:6364–6369. [PubMed]
  • Rassoulzadegan M., Cuzin F., Yang Y. APLP2, a member of the Alzheimer precursor protein family, is required for correct genomic segregation in dividing mouse cells. EMBO J. 1998;17:4647–4656. [PubMed]
  • Rehen S. K., McConnell M. J., Kaushal D., Kingsbury M. A., Yang A. H., Chun J. Chromosomal variation in neurons of the developing and adult mammalian nervous system. Proc. Natl. Acad. Sci. USA. 2001;98:13361–13366. [PubMed]
  • Ringman J. M., Rao P. N., Lu P. H., Cederbaum S. Mosaicism for trisomy 21 in a patient with young-onset dementia. Arch. Neurol. 2008;65:412–415. [PubMed]
  • Roberson E. D., Scearce-Levie K., Palop J. J., Yan F., Cheng I. H., Wu T., Gerstein H., Yu G. Q., Mucke L. Reducing endogenous tau ameliorates amyloid beta-induced deficits in an Alzheimer's disease mouse model. Science. 2007;316:750–754. [PubMed]
  • Rossi G., et al. A new function of microtubule-associated protein tau: involvement in chromosome stability. Cell Cycle. 2008;15:1788–1794. [PubMed]
  • Rovelet-Lecrux A., et al. APP locus duplication causes autosomal dominant early-onset Alzheimer disease with cerebral amyloid angiopathy. Nat. Genet. 2006;38:11–12. [PubMed]
  • Rowe I. F., Ridler M. A., Gibberd F. B. Presenile dementia associated with mosaic trisomy 21 in a patient with a Down syndrome child. Lancet. 1989;2:229. [PubMed]
  • Schapiro M. B., Kumar A., White B., Grandy C. L., Friedland R. P., Rapoport S. I. Alzheimer's disease (AD) in mosaic/translocation Down's syndrome (Ds) without mental retardation. Neurology. 1989;39:169.
  • Schupf N., Kapell D., Lee J. H., Ottman R., Mayeux R. Increased risk of Alzheimer's disease in mothers of adults with Down's syndrome. Lancet. 1994;344:353–356. [PubMed]
  • Shaked G. M., Kummer M. P., Lu D. C., Galvan V., Bredesen D. E., Koo E. H. Abeta induces cell death by direct interaction with its cognate extracellular domain on APP (APP 597–624) FASEB J. 2006;20:1254–1256. [PMC free article] [PubMed]
  • Sleegers K., Brouwers N., Gijselinck I., Theuns J., Goossens D., Wauters J., Del-Favero J., Cruts M., van Duijn C. M., Van Broeckhoven C. APP duplication is sufficient to cause early onset Alzheimer's dementia with cerebral amyloid angiopathy. Brain. 2006;129:2977–2983. [PubMed]
  • Small S. A., Duff K. Linking Abeta and tau in late-onset Alzheimer's disease: a dual pathway hypothesis. Neuron. 2008;60:534–542. [PMC free article] [PubMed]
  • Sola Vigo F., Kedikian G., Heredia L., Añel A. D., Rosa A. L., Lorenzo A. Amyloid-beta precursor protein mediate neuronal toxicity of amyloid beta through Go protein activation. Neurobiol. Aging. 2009;30:1379–1392. [PubMed]
  • Stokin G. B., et al. Axonopathy and transport deficits early in the pathogenesis of Alzheimer's disease. Science. 2005;307:1282–1288. [PubMed]
  • Suizu F., Ryo A., Wulf G., Lim J., Lu K. P. Pin1 regulates centrosome duplication, and its overexpression induces centrosome amplification, chromosome instability, and oncogenesis. Mol. Cell. Biol. 2006;26:1463–1479. [PMC free article] [PubMed]
  • Suzuki T., Oishi M., Marshak D. R., Czernik A. J., Nairn A. C., Greengard P. Cell cycle-dependent regulation of the phosphorylation and metabolism of the Alzheimer amyloid precursor protein. EMBO J. 1994;13:1114–1122. [PubMed]
  • Takashima A. GSK-3 is essential in the pathogenesis of Alzheimer's disease. J Alzheimer's Dis. 2006;9:309–317. [PubMed]
  • Tezapsidis N., Merz P. A., Merz G., Hong H. Microtubular interactions of presenilin direct kinesis of Abeta peptide and its precursors. FASEB J. 2003;17:1322–1324. [PubMed]
  • Thomas P., Fenech M. Chromosome 17 and 21 aneuploidy in buccal cells is increased with ageing and in Alzheimer's disease. Mutagenesis. 2008;23:57–65. [PubMed]
  • Townsend M., Cleary J. P., Mehta T., Hofmeister J., Lesne S., O'Hare E., Walsh D. M., Selkoe D. J. Orally available compound prevents deficits in memory caused by the Alzheimer amyloid-beta oligomers. Ann. Neurol. 2006;60:668–676. [PubMed]
  • Varvel N. H., Bhaskar K., Patil A. R., Pimplikar S. W., Herrup K., Lamb B. T. Abeta oligomers induce neuronal cell cycle events in Alzheimer's disease. J. Neurosci. 2008;28:10786–10793. [PMC free article] [PubMed]
  • Verret L., Jankowsky J. L., Xu G. M., Borchelt D. R., Rampon C. Alzheimer's-type amyloidosis in transgenic mice impairs survival of newborn neurons derived from adult hippocampal neurogenesis. J. Neurosci. 2007;27:6771–6780. [PMC free article] [PubMed]
  • Vincent I., Rosado M., Davies P. Mitotic mechanisms in Alzheimer's disease? J. Cell Biol. 1996;132:423–425. [PMC free article] [PubMed]
  • Vinogradova M. V., Malanina G. G., Reddy A. S., Fletterick R. J. Structure of the complex of a mitotic kinesin with its calcium binding regulator. Proc. Natl. Acad. Sci. USA. 2009;106:8175–8179. [PubMed]
  • Wakefield J. G., Stephens D. J., Tavare J. M. A role for glycogen synthase kinase-3 in mitotic spindle dynamics and chromosome alignment. J. Cell Sci. 2003;116:637–646. [PubMed]
  • Wang R., Dineley K. T., Sweatt J. D., Zheng H. Presenilin 1 familial Alzheimer's disease mutation leads to defective associative learning and impaired adult neurogenesis. Neuroscience. 2004;126:305–312. [PubMed]
  • Wang X., Schwarz T. L. The mechanism of Ca2+-dependent regulation of kinesin-mediated mitochondrial motility. Cell. 2009;136:163–174. [PMC free article] [PubMed]
  • Wen P. H., et al. The presenilin-1 familial Alzheimer disease mutant P117L impairs neurogenesis in the hippocampus of adult mice. Exp. Neurol. 2004;188:224–237. [PubMed]
  • Wisniewski T., Castaño E. M., Golabek A., Vogel T., Frangione B. Acceleration of Alzheimer's fibril formation by apolipoprotein E in vitro. Am. J. Pathol. 1994;145:1030–1035. [PubMed]
  • Wolfe M. S. The secretases of Alzheimer's disease. Curr. Top. Dev. Biol. 2003;54:233–261. [PubMed]
  • Wolozin B., Iwasaki K., Vito P., Ganjei J. K., Lacana E., Sunderland T., Zhao B., Kusiak J. W., Wasco W., D'Adamio L. Participation of presenilin 2 in apoptosis: enhanced basal activity conferred by an Alzheimer mutation. Science, 1996;274:1710–1713. [PubMed]
  • Wragg M., Hutton M., Talbot C. Genetic association between intronic polymorphism in presenilin-1 gene and late-onset Alzheimer's disease. Alzheimer's Disease Collaborative Group. Lancet. 1996;347:509–512. [PubMed]
  • Yang Y., Geldmacher D. S., Herrup K. DNA replication precedes neuronal cell death in Alzheimer's disease. J. Neurosci. 2001;21:2661–2668. [PubMed]
  • Yang Y., Varvel N. H., Lamb B. T., Herrup K. Ectopic cell cycle events link human Alzheimer's disease and amyloid precursor protein transgenic mouse models. J. Neurosci. 2006;26:775–784. [PubMed]
  • Yankner B. A., Dawes L. R., Fisher S., Villa-Komaroff L., Oster-Granite M. L., Neve R. L. Neurotoxicity of a fragment of the amyloid precursor associated with Alzheimer's disease. Science. 1989;245:417–420. [PubMed]
  • Zhang C., McNeil E., Dressler L., Siman R. Long-lasting impairment in hippocampal neurogenesis associated with amyloid deposition in a knock-in mouse model of familial Alzheimer's disease. Exp. Neurol. 2007;204:77–87. [PMC free article] [PubMed]
  • Zhao C., Deng W., Gage F. H. Mechanisms and functional implications of adult neurogenesis. Cell. 2008;132:645–660. [PubMed]
  • Zhu X., Siedlak S. L., Wang Y., Perry G., Castellani R. J., Cohen M. L., Smith M. A. Neuronal binucleation in Alzheimer disease hippocampus. Neuropathol. Appl. Neurobiol. 2008;34:457–465. [PubMed]
  • Zimmermann K., et al. Localization of the putative precursor of Alzheimer's disease-specific amyloid at nuclear envelopes of adult human muscle. EMBO J. 1988;7:367–372. [PubMed]
  • Zitnik G, Wang L., Martin G. M., Qubai Hu Q. Localizations of endogenous APP/APP-proteolytic products are consistent with microtubular transport. J. Mol. Neurosci. 2006;31:59–68. [PubMed]

Articles from Molecular Biology of the Cell are provided here courtesy of American Society for Cell Biology