PMCCPMCCPMCC

Search tips
Search criteria 

Advanced

 
Logo of jvirolPermissionsJournals.ASM.orgJournalJV ArticleJournal InfoAuthorsReviewers
 
J Virol. 2010 February; 84(4): 1989–2000.
Published online 2009 December 9. doi:  10.1128/JVI.01902-09
PMCID: PMC2812397

Fine Mapping of Pre-S Sequence Requirements for Hepatitis B Virus Large Envelope Protein-Mediated Receptor Interaction[down-pointing small open triangle]

Abstract

Previous studies showed that the N-terminal 75 amino acids of the pre-S1 domain of the hepatitis B virus (HBV) L protein are essential for HBV and hepatitis delta virus (HDV) infectivity. Consistently, synthetic lipopeptides encompassing this sequence or only parts of it efficiently block HBV and HDV infection, presumably through specific interference with a cellular receptor. Crucial for both virus infectivity and the inhibitory activity of the peptides are N-terminal myristoylation and a highly conserved motif within the N-terminal 48 amino acids. To refine the sequence requirements, we synthesized a series of HBV pre-S1 peptides containing deletions, point mutations, d-amino acid exchanges, or genotype-specific sequence permutations. Using the HepaRG cell line and a genotype D-derived virus, we determined the specific inhibitory activities of the peptides and found that (i) lipopeptides with an artificial consensus sequence inhibit HBV genotype D infection more potently than the corresponding genotype D peptides; (ii) point mutations, d-amino acid exchanges, or deletions introduced into the highly conserved part of the pre-S1 domain result in an almost complete loss of activity; and (iii) the flanking sequences comprising amino acids 2 to 8, 16 to 20, and, to a less pronounced extent, 34 to 48 gradually increase the inhibitory activity, while amino acids 21 to 33 behave indifferently. Taken together, our data suggest that HBV pre-S1-mediated receptor interference and, thus, HBV receptor recognition form a highly specific process. It requires an N-terminal acyl moiety and a highly conserved sequence that is present in primate but not rodent or avian hepadnaviruses, indicating different entry pathways for the different family members.

Hepatitis B viruses (HBVs) are small, enveloped DNA viruses that replicate their genome via reverse transcription of a pregenomic RNA transcript in the cytoplasm of infected hepatocytes (31). They are classified into the family Hepadnaviridae and are adapted to mammals (primates and rodents) and birds, where they cause acute and persistent infections. At present about 360 million people are chronically infected with the human HBV. Due to HBV-related progressive liver failure (cirrhosis or hepatocellular carcinoma) ≈650,000 people die each year (10). HBV, like duck hepatitis B virus (DHBV) or woodchuck hepatitis B virus (WHV), shows a pronounced species specificity and a remarkable liver tropism. These features have been assigned to specific early infection events, most likely receptor recognition. However, it cannot be excluded that other steps during or postentry contribute to the host restrictions of infection (13).

The HBV replication cycle has been deciphered in some detail. However, studies on the early infection events were hampered by the lack of appropriate in vitro infection systems. The establishment of the HBV-susceptible cell line HepaRG and systems based on primary human hepatocytes (PHH) and primary Tupaia belangeri hepatocytes resolved this issue and facilitated investigations on cellular and viral determinants involved in HBV entry. It became clear that infectivity can be assigned to different subdomains in two of the three viral envelope proteins (34). These three envelope proteins are termed large (L), middle (M), and small (S) proteins. They form a proteinaceous outer virus shell, which is embedded in an endoplasmic reticulum (ER)-derived lipid bilayer. Their coding mRNAs originate from one single open reading frame (4). Since their three start codons are in phase, L, M, and S proteins share the C-terminal 226 amino acids (termed the S domain in the context of the L and M proteins), which anchor the proteins via four putative transmembrane helices (TM domains) in the lipid bilayer. The S protein drives particle formation and accordingly serves an important function in virus assembly (4, 5). The S domain has further been shown to participate in virus entry since antibodies against the antigenic loop of S, located between TM domains 2 and 3, are neutralizing (11), and mutations introduced in this loop render assembled hepatitis delta virus (HDV) particles noninfectious (1, 20, 29). Linked to the N terminus of the S domain, the M and L proteins bear two hydrophilic extensions, one of 55 amino acids and, depending on genotype, one of 108 (genotype D), 118 (genotypes E and G), or 119 (genotypes A, B, C, F, H) amino acids called pre-S2 (M) and pre-S1 (L), respectively. The L proteins of all hepadnaviruses contain recognition motifs for N-myristoyltransferase (36, 37) and are accordingly subjected to this modification. The lack of a classical secretion signal in L results in an initial cytoplasmic orientation of its pre-S domains. After synthesis, myristoylation, and incorporation of the TM helices into the ER membrane, the pre-S domain of L traverses the lipid bilayer, allowing parts of it to become accessible at the particle exterior (7).

Crucial elements for virus attachment, specific receptor binding, or fusion have been identified within the L, M, and S proteins by two complementary approaches. One approach using HBV particles that were enveloped with mutated L proteins showed that myristoylation of L is mandatory for virus infectivity (6, 16). Successive deletions of 5 amino acids within the N-terminal pre-S1 sequence of residues 1 to 78 abrogated HBV infectivity (24). In contrast, most parts of the pre-S2 domain were dispensable for infection (23). Using HDV, these results were confirmed, indicating that both viruses share very similar entry modes (3). Moreover it became obvious that the S domain, either as part of the HBV L protein or as the S protein, being the major constituent of the viral envelope, is required (1, 20, 29). The second approach followed the observation that a synthetic myristoylated peptide consisting of the N-terminal amino acids 2 to 78 of the pre-S1 domain (HBVpreS/2-78myr) prevents HBV infection of PHH and HepaRG cells even at nanomolar concentrations (17). Surprisingly, C-terminal shortening of this sequence up to amino acid 48 increases the inhibitory activity of the peptide (15). This indicates two separable and distinct functions within the pre-S1 infectivity determinant consisting of residues 1 to 78: one is related to the inhibitory activity of the peptide through interference with a hepatocyte-specific receptor, and the other, involving amino acids 49 to 78, is still unknown. The requirement of the N-terminal myristic acid moiety in the inhibitory activity is to some extent variable. Replacement of myristic acid by other hydrophobic saturated and unsaturated fatty acid moieties or even by cholesterol allows the modulation of specific activities according to the relative hydrophobicity (14, 15, 27). Thus, lipophilicity per se and not a specific lipid structure seems to play the key role for this part of the molecule.

Previous studies using synthetic peptides or recombinantly produced fusion proteins carrying internal deletions and point mutations identified a highly conserved pre-S1 sequence element (amino acids 9 to 18 in genotype D) that is very important for infection competition (2, 9, 14). Single amino acid exchanges in this region abrogate the antiviral activity of the peptides and render the respective recombinant hepatitis B virions noninfectious (9).

Our recent observation that HBV pre-S1-derived lipopeptides are also potent inhibitors of HBV infection in vivo (27) suggests that the lead substance of this group of entry inhibitors may be suitable for clinical applications in cases of acute and possibly chronic HBV and HDV infection in the future.

In this report, we examined the capacity of synthetic HBV pre-S1-derived peptides to interfere with the HBV infection of HepaRG cells. By using this approach we (i) further narrowed down the minimal amino acid sequence requirements and the sensitivity to amino acid exchanges for interference with the HBV infection, (ii) characterized in more detail the role of N- and C-terminal deletions, and (iii) defined the consensus sequence derived from an alignment of the different HBV genotypes as the most active peptide and the lead substance for clinical development.

MATERIALS AND METHODS

Cell lines.

HepaRG cells were grown in Williams' medium E supplemented with 10% heat-inactivated fetal calf serum, 50 U of penicillin/ml, 50 μg of streptomycin/ml, 5 μg of insulin/ml, and 50 μM hydrocortisone hemisuccinate. The cells were passaged every 2 weeks at a ratio of 1:5. Fourteen days before infection, cell differentiation was induced by adding 2% dimethyl sulfoxide to the maintenance medium (17). The medium was exchanged every 3 days.

Infection competition assays.

As an infectious inoculum, HepAd38 (22) or HepG2.2.15 (32) cell culture supernatant, concentrated approximately 100-fold, was used. The inoculum was prepared from cell culture supernatants by precipitating viral particles with 6% polyethylene glycol 8000 (Sigma-Aldrich) for 12 to 16 h at 4°C. The precipitates were recovered by centrifugation (at 7,000 × g for 1 h at 4°C) and resuspended in phosphate-buffered saline (PBS) supplemented with 25% fetal calf serum. Aliquots were stored at −80°C. For infection, differentiated HepaRG cells (1 × 106 cells/well of a 12-well plate) were incubated with a 20-fold dilution of the concentrated virus stock in medium (corresponding to ≈4 × 1010 genome equivalents) supplemented with 4% polyethylene glycol 8000 for 16 h at 37°C. At the end of the incubation, the cells were washed three times and further cultivated. Medium was changed every 3 days. Competition experiments were performed in 12-well plates. To ensure comparability within one concentration series, all assays with one peptide were done in a single 12-well plate. To guarantee the best comparability between different peptides, the respective tests of different concentration series were performed in plates of the same batch of cells. HepaRG cells were preincubated for 30 min at 37°C with the chemically synthesized acylated HBV pre-S1 peptides, followed by coincubation of cells with the peptides and virus for 16 h at 37°C. To quantify the infection, amounts of hepatitis B surface antigen (HBsAg) and hepatitis B e antigen (HBeAg) secreted into the culture supernatant from day 7 to 11 postinfection (p.i.) were determined by enzyme-linked immunosorbent assay ([ELISA] AxSYM; Abbott). All competition experiments were performed in duplicate and repeated at least two times independently.

Quantification of cellular HBV binding.

Attachment of HBV to HepaRG cells was determined by quantitative PCR to detect the viral DNA. Binding/uptake was performed for 4 h at 37°C in the absence or presence of 200 μg/ml heparin or 1 μM HBVpreS/2-48myr (a synthetic myristoylated peptide consisting of N-terminal amino acids 2 to 48 of the pre-S1 domain). Unbound virus was removed by washing. Viral DNA was prepared from the cellular lysates with a NucleoSpin Blood Kit (Macherey-Nagel) according to the manufacturer's protocol. For the SYBR green-based real-time PCR (Invitrogen), the primer set Taq-HBV-F (5′-TCCCAGAGTGAGAGGCCTGTA-3′) and Taq-HBV-R (5′-ATCCTCGAGAAGATTGACGATAAGG-3′) was used. Quantitative PCR was performed in an ABI Prism 7000 Sequence Detection System (Applied Biosystems). The reaction process started at 50°C for 2 min and 95°C for 15 min, followed by 45 cycles at 95°C for 15 s and 60°C for 1 min. All experiments were performed at least twice.

Peptide synthesis, purification, and analysis.

All peptides were synthesized by standard solid-phase peptide synthesis employing the fluorenylmethoxycarbonyl/t-butyl (Fmoc/tBu) strategy and purified by semipreparative reversed-phase high-performance liquid chromatography (HPLC) on a Cromolith SemiPrep column (Merck). The purity of all peptides was verified by analytical HPLC on a Performance Cromolith column (Merck). As solvents for analytical HPLC, 0.1% aqueous trifluoroacetic acid (solvent A) and acetonitrile containing 0.1% trifluoroacetic acid (solvent B) were used. The analysis was performed by applying a linear gradient (flow rate of 4 ml/min) from 0 to 100% solvent B within 5 min. The identity of the peptides was verified by mass spectrometry. The peptide WHVpreS/2-81myr (2-GNNIKVTFNPDKIAAWWPAVGTYYTTTYPQNQSVFQPGIYQTTSLINPKNQQELDSVLINRYKQIDWNTWQGFPVDQKLP-81) was purchased from Peptide Specialty Laboratories GmbH (Heidelberg, Germany). For infection competition experiments, stock solutions of the peptides in dimethyl sulfoxide were prepared, prediluted in medium, and added to the cells at the concentrations indicated in the figures.

Immunofluorescence (IF) analyses.

At 11 days p.i. the HepaRG cells were washed with PBS, fixed with 4% paraformaldehyde in PBS for 15 min at room temperature, and permeabilized with 0.25% (vol/vol) Triton X-100 in PBS (30 min at room temperature). After a washing step, a hepatitis B core antigen (HBcAg)-specific polyclonal antibody (H363; provided by Heinz Schaller, ZMBH, University of Heidelberg, Germany) at a dilution of 1:1,000 in PBS containing 5% skim milk powder was added. Following overnight incubation at 4°C, cells were washed and incubated in the dark for 1 h at room temperature with a 1:500 dilution of an Alexa Fluor 488-conjugated secondary antibody (Invitrogen/Molecular Probes) in PBS containing 5% skim milk powder. After a washing step, cells were incubated for 30 min with a 1 μg/ml solution of 4′, 6′-diamidino-2′-phenylindole dihydrochloride (DAPI; Roche Applied Science). Cells were washed three times with PBS. Images were acquired with an inverted fluorescence microscope (Leica, Germany). All images were made under identical settings and afterwards handled identically. The images were analyzed using ImageJ software. The nucleus counter function of the Wright Cell Imaging Facility (WCIF) plug-in was used to count the number of labeled nuclei (DAPI). The cell counter plug-in was used to count the number of HBcAg-positive cells. For each peptide and concentration, four images were analyzed.

RESULTS

Sequence-specific and acylation-dependent inhibition of HBV infection by synthetic lipopeptides derived from the N-terminal pre-S1 domain of the HBV L protein.

To substantiate the specificity of infection inhibition by HBV pre-S1-derived peptides, we infected differentiated HepaRG cells with HBV (genotype D) in the presence of increasing concentrations (1, 5, 25, 100, and 1,000 nM) of HBVpreS/2-48stearoyl, the N-terminally stearoylated pre-S1-derived peptide of genotype D; HBVpreS/2-48scrambledstearoyl, an N-terminally stearoylated peptide of the same amino acid composition but with randomized sequence; and HBVpreS/1-48, the nonstearoylated pre-S1 peptide carrying instead of a lipid moiety the initially biosynthesized methionine in position 1 (Table (Table1).1). Prior to the infection inhibition experiments, the purity of all synthesized peptides was controlled by HPLC, as shown for the three peptides in Fig. Fig.1A.1A. The peptides eluted in a single peak with no detectable side products or contaminations. A clear increase in the retention time (2.3 to 3.7 min) was observed for the stearoylated peptides compared to the nonacylated HBVpreS/2-48, indicating that nonacylated side products were completely removed.

FIG. 1.
HBVpreS/2-48stearoyl efficiently inhibits HBV infection of HepaRG cells, requires N-terminal acylation, and does not obstruct HBV attachment at concentrations up to 1 μM. (A) Elution profiles of analytical HPLC runs of HBVpreS/2-48stearoyl, HBVpreS/2-48scrambled ...
TABLE 1.
Name, primary sequence, and in vitro inhibitory activity of the tested HBV peptidesa

Consistent with earlier results (15), HBVpreS/2-48stearoyl inhibited HBV infection by more than 80% at a concentration of 1 nM (as measured by secreted HBsAg between days 7 to 11 p.i.) (Fig. (Fig.1B).1B). Concentrations of >1 nM reduced HBsAg in the supernatant to almost the detection limit of the ELISA. In contrast, neither HBVpreS/2-48scrambledstearoyl nor the nonstearoylated pre-S1 peptide was able to interfere with infection even at 1 μM. This confirms the specificity of the assay within this concentration range and excludes nonspecific effects caused by, for example, the acyl moiety. In a separate experiment performed under the same conditions but applying lower peptide concentrations, the half-maximal inhibitory concentration (IC50) of HBVpreS/2-48stearoyl was determined to be ≈400 pM (data not shown). Using a WHV-derived peptide (WHVpreS/2-81myr) no interference with the in vitro HBV infection was observed while a parallel control experiment using 1 μM HBVpreS/2-48myr completely abolished infection.

It has been shown that inoculation of HepaRG cells with acylated pre-S1 peptides prior to infection results in inhibition, indicating that the peptides address a cellular factor (15). In addition, we along with others identified heparan sulfate proteoglycans (HSPG) as the primary cellular attachment sites of HBV (25, 30). To investigate if pre-S1-derived lipopeptides interfere with binding of the viral particles to cellular HSPG, we compared the HBV cell association in the presence of heparin or HBVpreS/2-48myr (Fig. (Fig.1C).1C). Addition of 200 μg/ml heparin led to a 62% reduction of cell-associated viral genome equivalents in comparison to the untreated control. In contrast, the presence of 1 μM HBVpreS/2-48myr, a concentration that blocks infection, had no influence on HBV cell association, indicating that the HBV pre-S1 peptides do not affect primary attachment. To analyze whether HBV pre-S1 lipopeptides act at a postfusion step, we added HBVpreS/2-48stearoyl 16 h after the beginning of virus inoculation (Fig. (Fig.1D).1D). While coincubation with the virus led to a more than 80% reduction of infection, addition of the peptide at 16 h postinoculation was without effect. To verify the results of the infection inhibition experiments on a single-cell level, we performed HBcAg-specific IF analyses. While a subset of differentiated HepaRG cells stained positively for HBcAg in the untreated control infection, only sporadic infection events could be observed in the presence of 250 nM or 2.5 μM HBVpreS/2-48stearoyl (Fig. (Fig.1E).1E). As determined by cell counting, this corresponds to 0.06% (at 250 nM) and 0.02% (at 2.5 μM) of HBcAg-positive cells of the control infection (Fig. (Fig.1F).1F). Under the same conditions HBVpreS/2-48scrambledstearoyl did not lead to a significant reduction of HBcAg-expressing cells (98% at 250 nM and 77% at 2.5 μM). Parallel quantification of HBsAg secreted from days 7 to 11 p.i. showed a reduction to 18% of the control infection for 250 nM and 2.5 μM HBVpreS/2-48stearoyl (Fig. (Fig.1G),1G), indicating that some part of the observed HBsAg in the measurement is most likely due to remaining input virus. In accordance with the IF results, the addition of 250 nM or 2.5 μM HBVpreS/2-48scrambledstearoyl had no effect on the HBV infection. HBcAg-specific IF was also performed for the subsequent experiments. These analyses confirmed the results obtained by the HBsAg/HBeAg measurements (data not shown).

Influence of C-terminal truncations of HBVpreS/2-48stearoyl.

It has been previously shown that successive C-terminal shortening of HBVpreS/2-48stearoyl up to amino acid 18 results in a significant but not complete loss of the inhibitory activity of the peptide (2, 14). To refine the contribution of the sequence elements located within this segment and to specifically address the role of the pre-S1 amino acids 15 to 18, we chemically synthesized the peptides HBVpreS/2-33stearoyl, HBVpreS/2-26stearoyl, HBVpreS/2-21stearoyl, and HBVpreS/2-15stearoyl and quantified their HBV-inhibitory activity in concentrations ranging from 1 nM to 1 μM. As shown in Fig. Fig.2,2, HBVpreS/2-33stearoyl exhibited about a 10-fold reduced activity compared to HBVpreS/2-48stearoyl. Further truncations up to amino acid 21 had only a marginal influence on the respective IC50s, indicating that this part of the pre-S1 sequence, although containing the two major neutralizing B-cell epitopes 20-DPAF-23 (19) and 26-NTANPDW-32 (28), does not contribute substantially to the inhibitory activity of the peptide. In contrast, removal of the next six adjacent amino acids increased the IC50 by an extra factor of ≈100 to ≈400 nM. This demonstrates an important contribution of amino acids 16-DHQLD-20 and, to a lesser extent, of amino acids 34 to 48 to infection inhibition. To analyze the influence of the two aforementioned neutralizing B-cell epitopes in more detail, HBVpreS/2-48(P21A F23A N29A P30A)stearoyl, a peptide comprising the four point mutations P21A, F23A, N29A, and P30A in this region, was tested. It exhibited about a 25-fold reduction in the IC50 compared to HBVpreS/2-48stearoyl (Fig. (Fig.2,2, right), supporting the notion that changes in these immunogenic epitopes have only moderate effects although the corresponding monoclonal antibodies block infection very efficiently (12, 26; also data not shown).

FIG. 2.
Infection inhibition activities of C-terminally shortened and antigenically altered HBV pre-S1 lipopeptides. HBV infection competition experiments on HepaRG cells using increasing concentrations (0 to 1,000 nM) of the indicated peptides. All peptide names ...

Effects of incremental N-terminal single amino acid deletions on infection inhibition.

Using HDV as a surrogate system to study HBV-receptor interactions, Barrera et al. previously demonstrated that neither insertion of a methionine between residue G-2 and the myristic acid nor deletion of amino acids 2 to 4 and fusion of the hydrophobic moiety to residue L-5 results in abrogation of the inhibitory activity (2). This indicates that the N-terminal positioning of the lipid as well as the length of the lipid-bound amino acid sequence can be varied to some extent. To quantify the contribution of single amino acids within this very N-terminal part of the peptide, we performed comparative competition experiments using peptides with consecutive N-terminal truncations (HBVpreS/5-48stearoyl, HBVpreS/6-48stearoyl, HBVpreS/7-48stearoyl, and HBVpreS/9-48stearoyl) and peptides that carry polyalanine stretches of the respective length instead of the authentic sequence [HBVpreS/2-48stearoyl(A2-8) and HBVpreS/2-48stearoyl(A2-9), with alanines at residues 2 to 8 and 2 to 9, respectively].

As shown in Fig. Fig.3A,3A, removal of the three N-terminal amino acids 2-GQN-4 (corresponding to the peptide HBVpreS/5-48stearoyl) reduced the IC50 of the full-length peptide HBVpreS/2-48stearoyl by a factor of ≈7.5 (IC50 of ≈3 nM). Deletion of the next four amino acids (matching the peptide HBVpreS/9-48stearoyl) resulted in a ≈2,500-fold reduced but still significant specific activity (IC50 of ≈1,000 nM). This emphasizes an important contribution of the motif 5-LSTS-8 for the peptide activity. Incremental shortening from amino acid 5 to 9 (corresponding to the peptides HBVpreS/5-48stearoyl, HBVpreS/6-48stearoyl, HBVpreS/7-48stearoyl, and HBVpreS/9-48stearoyl) led to steadily decreased IC50s (Fig. (Fig.3B).3B). HBVpreS/7-48stearoyl, which includes residues S-8 and T-7, exhibited an ability to interfere with HBV infection that is comparable to that of HBVpreS/9-48stearoyl while the presence of S-6 enhanced the activity by a factor of about 14.

FIG. 3.
Infection inhibition activity of N-terminally shortened or modified HBVpre-S1 lipopeptides. (A to C) HBV infection inhibition using increasing concentrations (0 to 1 μM or 0 to 10 μM) of HBVpreS/5-48stearoyl and HBVpreS/9-48stearoyl (A); ...

To test whether the nine N-terminal amino acids serve a specific function or simply provide a spacer and/or myristoylation recognition sequence, we replaced amino acids 2 to 8 [HBVpreS/2-48(A2-8)stearoyl] or 2 to 9 [HBVpreS/2-48(A2-9)stearoyl] by alanine stretches and compared the activities of these peptides with activity of the deletion mutant HBVpreS/9-48stearoyl (Fig. (Fig.3C).3C). To better evaluate the specific activities, the maximal peptide concentration in these assays was raised to 10 μM. HBVpreS/9-48stearoyl and HBVpreS/2-48(A2-8)stearoyl displayed comparable activities (IC50 of 1 to 4 μM; 80% inhibitory concentration [IC80] of ≈10 μM), indicating that the N-terminal seven amino acids of the pre-S1 sequence contribute to the inhibitory activity in a sequence-specific manner. Notably, replacement of N-9 by alanine [HBVpreS/2-48(A2-9)stearoyl] led to a complete abrogation of infection inhibition at concentrations up to 10 μM. We thus consider residue N-9 essential.

Combined N- and C-terminal truncations of HBVpreS/2-48stearoyl do not cooperatively influence the infection inhibition.

To determine whether the previously defined N- and C-terminal sequence elements cooperatively influence each other, we tested peptides with combined deletions of the N and C termini (HBVpreS/5-33stearoyl and HBVpreS/9-33stearoyl) and compared their infection inhibition activity with the previously determined IC50s. As shown in Fig. Fig.4,4, combination of the truncations did not further reduce the peptide activity. HBVpreS/5-33stearoyl displayed an IC50 of approximately 10 nM while HBVpreS/9-33stearoyl had an IC50 of ≈500 nM.

FIG. 4.
Infection inhibition activity of combined N- and C-terminally deleted HBV pre-S1 lipopeptides. HBV infection competition using 0, 1, 5, 25, 100, and 1,000 nM HBVpreS/5-33stearoyl or HBVpreS/9-33stearoyl. All peptide names have been shortened due to size ...

The integrity of a highly conserved pre-S sequence of primate hepadnaviruses encompassing amino acids 11 to 15 is crucial for infection inhibition.

Our previous studies using Escherichia coli-derived myristoylated HBV pre-S-glutathione S-transferase (GST) fusion proteins revealed that amino acids 11 to 15 play a profound role in both the inhibitory activity of the peptides (shown by deletions and point mutations in the pre-S1 part of the fusion proteins) and the infectivity of the corresponding HBV mutants (shown by infection assays using genetically altered viruses produced in hepatoma cells) (9). To more precisely analyze the role of this highly conserved sequence, we chemically synthesized peptides that either comprise a complete deletion of this sequence [HBVpreS/2-48(Δ11-15)stearoyl], carry alanine substitutions for these five residues [HBVpreS/2-48(A11-15)stearoyl], or have incorporated the respective d-enantiomeric amino acids at position 11, 13, 14, and 15 [HBVpreS/2-48(d-11/13-15)stearoyl]. Consistent with our previous results, deletion of amino acids 11 to 15 resulted in a complete loss of the inhibitory activity even at concentrations of 1 μM (Fig. (Fig.5A)5A) and 2.5 μM (data not shown). Replacement of 11-LGFFP-15 by alanines could not rescue the activity, confirming the sequence requirement. Interestingly, replacement of L-11, F-13, F-14, and P-15 with the respective d-amino acids also led to the complete inactivation of the peptide. The same held true when only two of these four d-amino acids, at positions 11 and 13, were exchanged (Fig. (Fig.5B).5B). This not only points at the importance of these residues but also indicates a stereo-selective interaction of the peptide with its putative cellular receptor. To investigate the contribution of single amino acids within this region, we compared the inhibitory activity of peptides carrying the exchanges L11R, G12E, or F13S. They have been reported to render the respective virus noninfectious (9). While HBVpreS/2-48(G12E)stearoyl and HBVpreS/2-48(F13S)stearoyl showed a residual activity at 1,000 nM, HBVpreS/2-48(L11R)stearoyl had no effect on infection at this concentration (Fig. (Fig.5C).5C). These data indicate that L-11 (similar to N-9) contributes with a high impact to the peptide activity. These results were supported by the IF analyses using 250 nM or 2.5 μM peptides (Fig. 5D and E).

FIG. 5.
Infection inhibition activity of HBV pre-S1 lipopeptides carrying mutations in the genotypically highly conserved region 11-LGFFP-15. (A to C) HBV infection competition experiments using 0 to 1,000 nM HBVpreS/2-48(Δ11-15)stearoyl, HBVpreS/2-48(A11-15) ...

Genotypic cross-inhibition with HBVpre-S1-derived lipopeptides encompassing the consensus sequences of genotypes A to H.

We have previously shown that the IC50s of pre-S1-derived peptides can be modulated by changing the length and, as a result, the hydrophobicity of the N-terminal acyl moiety (15). Through modification with palmitic or stearic acid, it was possible to generate inhibitors with about 10-fold increased specific activities compared to the authentically myristoylated peptides. Furthermore, preincubation experiments led us to the hypothesis that HBV pre-S1-derived lipopeptides address a cellular receptor and render it nonfunctional for supporting the subsequent virus entry (15). Assuming that the different HBV genotypes (as well as other primate hepadnaviruses containing the aforementioned conserved pre-S sequence) address the same receptor, we would expect a peptide consisting of the consensus sequence of genotypes A to H to be inhibitory for a genotype D-derived virus.

The alignment of the HBV genotypes A to H (Fig. (Fig.6A)6A) showed that, in comparison to genotype D, all other genotypes contain an additional 10 (E and G) or 11 (A, B, C, F, and H) N-terminal pre-S1 amino acids. Furthermore, all genotypes share the conserved region comprising amino acids 9 to 21. This sequence is also present in the hepatitis B viruses isolated from chimpanzee, gorilla, and woolly monkey. Based on this, we synthesized four peptides which differ in length (58 versus 47 amino acids) and in their N-terminal modifications (stearoylation versus myristoylation). Since genotypes A, B, C, F, and H include an additional 11 amino acids and genotypes E and G have an additional 10 N-terminal pre-S1 amino acids in comparison to genotype D, the consensus peptide consists of 58 amino acids (starting at position −11 relative to genotype D sequence). This peptide, termed HBVpreS/(−11)-48cons, and a corresponding peptide which was truncated by this 11 additional amino acids (HBVpreS/2-48cons) were modified with stearic or myristic acid and tested for their inhibitory potential. HBVpreS/(−11)-48consstearoyl had an IC50 (IC50 ≈200 pM) similar to that of the stearoylated genotype-D derived peptide lacking the 11 amino acids (IC50 of ≈400 pM) (Fig. (Fig.6B6B and data not shown). This indicates a genotype-spanning inhibitory activity and shows that insertion of additional amino acids at the amino terminus of pre-S1—in contrast to the deletions described above—is tolerated. Consistent with earlier findings (15), replacement of the authentic myristic acid by stearic acid resulted in about a 2.5-fold reduction of the IC50 (200 to 500 pM). Interestingly, removal of the 11 N-terminal amino acids from the consensus peptides resulted in a significant (2.5- to 5-fold) increase of their activities, with IC50s for HBVpreS/2-48consmyr and HBVpreS/2-48consstearoyl of 140 pM and 80 pM, respectively. Thus, the artificially shortened consensus sequence-derived lipopeptides are more potent in inhibiting a genotype D HBV infection than the peptides with the respective authentic sequence. This again indicates that the peptides act via targeting a cellular factor. Moreover, our results define the consensus sequence-derived peptide as the most promising inhibitor for future preclinical and clinical development.

FIG. 6.
Infection inhibition activity of myristoylated and stearoylated HBVpre-S1-derived peptides comprising the complete or a shortened consensus sequence. (A) Sequence alignment of the human HBV genotypes A to H and the chimpanzee, gorilla, and woolly monkey ...

DISCUSSION

In this study we extended and refined previous investigations that characterized synthetic lipopeptides or recombinant fusion proteins derived from the N-terminal half of the pre-S1 domain of the L protein with respect to their inhibitory effect on HBV entry into hepatocytes (2, 9, 14, 15, 17, 27). Taking advantage of solid-phase peptide synthesis in contrast to production of recombinant fusion proteins as described previously (9), we were able to apply higher peptide concentrations and thus determine IC50s of only weak inhibitors. Moreover, the opportunity to acylate at any position in the primary sequence allowed us to discriminate sequence requirements for recognition of N-myristoyltransferase from those that are important in receptor binding. Regarding the results of our mutational analyses, the N-terminal pre-S1 part could be dissected into different sequence elements. (i) Amino acids N-9, L-11, G-12, and F-13, located in a highly conserved part of the pre-S1 domain (amino acids 9 to 21), are essential for the peptide activity since deletions or amino acid exchanges lead to an abrogation of infection. Since the exchange of amino acids 11 and 13 or 11 and 13 to 15 by their respective d-enantiomers also resulted in a complete loss of activity, we have to assume a stereo-selective interaction of this “active site” of the peptide with a receptor on the hepatocyte surface. In addition to the previous data of Engelke et al., who demonstrated the importance of these amino acids using recombinant pre-S-GST fusion proteins, we could demonstrate by using higher peptide concentrations that L-11 has the highest impact on peptide activity. Following these observations, we narrowed down the active site of the peptide to the amino acid motif 9-NPLGFFP-15. (ii) The 8 amino acids following the myristoylation site in genotype D serve a specific role that exceeds the function of a simple spacer or recognition sequence for the N-myristoyltransferase. (iii) Two sequence elements (amino acids 16 to 20 and 34 to 48) fulfill accessory functions in inhibition activity while amino acids 21 to 33, containing the two major B-cell epitopes of the pre-S1 domain, serve a different role. The extent to which the two sequences with accessory function contribute to the HBV infection in the context of the pre-S1 domain of the HBV L protein in the viral particle remains to be determined. (iv) An artificial peptide consisting of the consensus sequence of all known primate genotypes is able to inhibit infection of genotype D virus with about a 5-fold increase in inhibitory activity. Besides a deeper understanding of the determinants for HBV receptor recognition, our results provide important clinical implications regarding the choice of the lead substance of an HBV entry inhibitor and the cross-genotype applicability of the substance.

Evidence for a highly specific interaction of the pre-S1 domain of the L protein with a hepatocyte receptor at some step during HBV entry comes from the observation that an HBV pre-S1 peptide with a scrambled amino acid sequence is unable to significantly interfere with infection at concentrations up to 2.5 μM (Fig. 1B and G). This excludes unspecific effects that could have been mediated by the interaction of the myristic acid with membranes. The observation that addition of the wild-type lipopeptide 16 h after the initiation of infection has no effect further confirmed that we specifically interfered with an early entry event, such as receptor recognition or membrane fusion.

The pre-S1 sequence identified here as the essential part of a more extended HBV receptor binding site is common in the different human HBV genotypes and the primate hepadnaviruses isolated from chimpanzee, woolly monkey, gorilla, and orangutan. It shows homology neither to the pre-S domain of other mammalian hepadnaviruses, e.g., from woodchucks and ground squirrels, nor to the pre-S domain of the avian hepadnaviruses. The absence of this motif in rodent and avian L proteins together with its requirement for infection (in the context of the viral L protein) and infection inhibition (as part of an inhibitory lipopeptide) leads to the hypothesis that avian, rodent, and mammalian hepadnaviruses address three different entry receptors and follow different entry pathways. For the avian viruses, it has been shown that carboxypeptidase D plays a crucial role in virus entry (21, 33). For HBV all attempts to assign a role of human carboxypeptidase D in entry were unsuccessful (S. Urban, unpublished results). The fact that myristoylated pre-S-derived peptides of duck and heron hepatitis B virus block DHBV infection of primary duck hepatocytes (35) but, on the other hand, do not substantially interfere with the human HBV infection (9, 14, 15) supports the aforementioned hypothesis. For WHV the situation has not been fully investigated. The lack of sequence homology to DHBV and HBV pre-S as well as the absence of inhibitory activity of WHVpreS/2-81myr in HBV (Fig. (Fig.1B)1B) and HDV (18) infections further strengthens the hypothesis of different entry receptors for rodent and primate hepadnaviruses. However, taking into account that a WHV surface protein-enveloped human HDV can infect PHH (18) and HepaRG cells (unpublished results), we have to assume that these cells of human origin possess a pre-S receptor for both viruses. Since there is no report for the productive infection of PHH by WHV, we have to assume that additional restrictions besides entry are involved in the species-specific replication of hepadnaviruses. Support for this assumption comes from the additional observation that a woolly monkey hepatitis B virus (WMHBV)-derived pre-S peptide is able to inhibit HBV infection (15); also WMHBV cannot infect PHH (8). Thus, the pronounced host specificity of hepadnaviruses can only partially be explained by the presence or absence of a specific receptor. Other postentry steps may play important roles as well.

Although the precise mechanism of the inhibitory effect of the HBV pre-S1-derived peptides is not understood, there is accumulating evidence that the lipopeptides primarily address a specific target on differentiated hepatic cells. This is based on the observation that preincubation of PHH or HepaRG cells with HBVpreS/2-48myr resulted in the abrogation of infection for several hours even when the peptide was absent during virus inoculation (15). Our observation that myristoylated and stearoylated peptides made up of an artificial consensus sequence show increased inhibitory activities compared to the respective peptides composed of the identical sequence present in the L protein of the infectious inoculum further supports this conclusion indirectly. Direct evidence for a sequence-specific and acyl moiety-dependent interaction with hepatocytes came from binding studies using fluorescently labeled lipopeptide conjugates (15). Using peptides with the point mutations defined in the infection inhibition experiments above, we could demonstrate specific binding of only the peptides with inhibitory activity to differentiated HepaRG cells and PHH and, surprisingly, also to primary hepatocytes of other non-HBV-susceptible species (unpublished results). It has been hypothesized that pre-S1-derived peptides block the primary attachment sites of HBV on the surface of hepatocytes since binding of L protein-enriched subviral particle preparations to primary Tupaia hepatocytes can be inhibited by HBVpreS/2-48myr at micromolar concentrations (14). However, the lack of binding inhibition at the concentrations which are sufficient to block infection (Fig. (Fig.1C)1C) and the observation that the IC50s for heparin-mediated binding and infection competition are comparable (30) suggest a multistep entry process. This process may start with a low-affinity binding to cellular but not only hepatocyte-specific HSPG. It is followed by a high-affinity transfer to a hepatocyte-specific receptor that is blocked by acylated peptides in a complex manner (e.g., a dominant negative effect in the course of cooperative receptor binding). With regard to the viral particle, it is reasonable that the N-terminal pre-S sequence as part of the L protein and represented by the peptide is not freely accessible on the virus surface but may be released only after primary binding in the presence of the receptor.

Our previous observation that pre-S1-derived lipopeptides inhibit HBV infection of PHH-transplanted uPA/RAG-2 mice after subcutaneous application at very low dosing (27) opens a new therapeutic opportunity for the treatment of HBV- and HDV-infected patients. The demonstration that a peptide encompassing the consensus sequence of all known primate genotypes is able to inhibit infection of genotype D virus more potently than the respective autologous peptide provides important clinical implications regarding the choice of the lead substance of an HBV entry inhibitor. The observation that recombinant pseudotyped HBV with L proteins of genotypes B, C, E, and G are equally sensitive to inhibition with a consensus peptide (data not shown) indicates the cross-genotype applicability of the substance and strengthens the hypothesis that the peptide addresses a cellular receptor. Moreover, since the shortened versions of this sequence, HBVpreS/2-48consmyr and HBVpreS/2-48consstearoyl, are the most active peptides characterized so far, they represent promising lead substances for preclinical studies and possible future clinical trials.

Acknowledgments

We thank Martina Spille for technical assistance and Thomas Müller for the synthesis of some peptides. We are grateful to Heinz Schaller for providing the H363 antibody. We are indebted to Ralf Bartenschlager, who constantly supports our work.

This work was funded by the Bundesministerium für Bildung und Forschung (BMBF), Innovative Therapieverfahren, grant number 01GU0702.

Footnotes

[down-pointing small open triangle]Published ahead of print on 9 December 2009.

REFERENCES

1. Abou-Jaoude, G., and C. Sureau. 2007. Entry of hepatitis delta virus requires the conserved cysteine residues of the hepatitis B virus envelope protein antigenic loop and is blocked by inhibitors of thiol-disulfide exchange. J. Virol. 81:13057-13066. [PMC free article] [PubMed]
2. Barrera, A., B. Guerra, L. Notvall, and R. E. Lanford. 2005. Mapping of the hepatitis B virus pre-S1 domain involved in receptor recognition. J. Virol. 79:9786-9798. [PMC free article] [PubMed]
3. Blanchet, M., and C. Sureau. 2007. Infectivity determinants of the hepatitis B virus pre-S domain are confined to the N-terminal 75 amino acid residues. J. Virol. 81:5841-5849. [PMC free article] [PubMed]
4. Bruss, V. 2007. Hepatitis B virus morphogenesis. World J. Gastroenterol. 13:65-73. [PubMed]
5. Bruss, V., and D. Ganem. 1991. The role of envelope proteins in hepatitis B virus assembly. Proc. Natl. Acad. Sci. U. S. A. 88:1059-1063. [PubMed]
6. Bruss, V., J. Hagelstein, E. Gerhardt, and P. R. Galle. 1996. Myristylation of the large surface protein is required for hepatitis B virus in vitro infectivity. Virology 218:396-399. [PubMed]
7. Bruss, V., X. Lu, R. Thomssen, and W. H. Gerlich. 1994. Post-translational alterations in transmembrane topology of the hepatitis B virus large envelope protein. EMBO J. 13:2273-2279. [PubMed]
8. Chouteau, P., J. Le Seyec, I. Cannie, M. Nassal, C. Guguen-Guillouzo, and P. Gripon. 2001. A short N-proximal region in the large envelope protein harbors a determinant that contributes to the species specificity of human hepatitis B virus. J. Virol. 75:11565-11572. [PMC free article] [PubMed]
9. Engelke, M., K. Mills, S. Seitz, P. Simon, P. Gripon, M. Schnolzer, and S. Urban. 2006. Characterization of a hepatitis B and hepatitis delta virus receptor binding site. Hepatology 43:750-760. [PubMed]
10. Ganem, D., and A. M. Prince. 2004. Hepatitis B virus infection—natural history and clinical consequences. N. Engl. J. Med. 350:1118-1129. [PubMed]
11. Glebe, D. 2006. Attachment sites and neutralising epitopes of hepatitis B virus. Minerva Gastroenterol. Dietol. 52:3-21. [PubMed]
12. Glebe, D., M. Aliakbari, P. Krass, E. V. Knoop, K. P. Valerius, and W. H. Gerlich. 2003. Pre-s1 antigen-dependent infection of Tupaia hepatocyte cultures with human hepatitis B virus. J. Virol. 77:9511-9521. [PMC free article] [PubMed]
13. Glebe, D., and S. Urban. 2007. Viral and cellular determinants involved in hepadnaviral entry. World J. Gastroenterol. 13:22-38. [PubMed]
14. Glebe, D., S. Urban, E. V. Knoop, N. Cag, P. Krass, S. Grun, A. Bulavaite, K. Sasnauskas, and W. H. Gerlich. 2005. Mapping of the hepatitis B virus attachment site by use of infection-inhibiting preS1 lipopeptides and Tupaia hepatocytes. Gastroenterology 129:234-245. [PubMed]
15. Gripon, P., I. Cannie, and S. Urban. 2005. Efficient inhibition of hepatitis B virus infection by acylated peptides derived from the large viral surface protein. J. Virol. 79:1613-1622. [PMC free article] [PubMed]
16. Gripon, P., J. Le Seyec, S. Rumin, and C. Guguen-Guillouzo. 1995. Myristylation of the hepatitis B virus large surface protein is essential for viral infectivity. Virology 213:292-299. [PubMed]
17. Gripon, P., S. Rumin, S. Urban, J. Le Seyec, D. Glaise, I. Cannie, C. Guyomard, J. Lucas, C. Trepo, and C. Guguen-Guillouzo. 2002. Infection of a human hepatoma cell line by hepatitis B virus. Proc. Natl. Acad. Sci. U. S. A. 99:15655-15660. [PubMed]
18. Gudima, S., Y. He, N. Chai, V. Bruss, S. Urban, W. Mason, and J. Taylor. 2008. Primary human hepatocytes are susceptible to infection by hepatitis delta virus assembled with envelope proteins of woodchuck hepatitis virus. J. Virol. 82:7276-7283. [PMC free article] [PubMed]
19. Heermann, K. H., U. Goldmann, W. Schwartz, T. Seyffarth, H. Baumgarten, and W. H. Gerlich. 1984. Large surface proteins of hepatitis B virus containing the pre-S sequence. J. Virol. 52:396-402. [PMC free article] [PubMed]
20. Jaoude, G. A., and C. Sureau. 2005. Role of the antigenic loop of the hepatitis B virus envelope proteins in infectivity of hepatitis delta virus. J. Virol. 79:10460-10466. [PMC free article] [PubMed]
21. Kuroki, K., F. Eng. T. Ishikawa, C. Turck, F. Harada, and D. Ganem. 1995. gp180, a host cell glycoprotein that binds duck hepatitis B virus particles, is encoded by a member of the carboxypeptidase gene family. J. Biol. Chem. 270:15022-15028. [PubMed]
22. Ladner, S. K., M. J. Otto, C. S. Barker, K. Zaifert, G. H. Wang, J. T. Guo, C. Seeger, and R. W. King. 1997. Inducible expression of human hepatitis B virus (HBV) in stably transfected hepatoblastoma cells: a novel system for screening potential inhibitors of HBV replication. Antimicrob. Agents Chemother. 41:1715-1720. [PMC free article] [PubMed]
23. Le Seyec, J., P. Chouteau, I. Cannie, C. Guguen-Guillouzo, and P. Gripon. 1998. Role of the pre-S2 domain of the large envelope protein in hepatitis B virus assembly and infectivity. J. Virol. 72:5573-5578. [PMC free article] [PubMed]
24. Le Seyec, J., P. Chouteau, I. Cannie, C. Guguen-Guillouzo, and P. Gripon. 1999. Infection process of the hepatitis B virus depends on the presence of a defined sequence in the pre-S1 domain. J. Virol. 73:2052-2057. [PMC free article] [PubMed]
25. Leistner, C. M., S. Gruen-Bernhard, and D. Glebe. 2008. Role of glycosaminoglycans for binding and infection of hepatitis B virus. Cell Microbiol. 10:122-133. [PubMed]
26. Maeng, C. Y., C. J. Ryu, P. Gripon, C. Guguen-Guillouzo, and H. J. Hong. 2000. Fine mapping of virus-neutralizing epitopes on hepatitis B virus PreS1. Virology 270:9-16. [PubMed]
27. Petersen, J., M. Dandri, W. Mier, M. Lutgehetmann, T. Volz, W. F. von, U. Haberkorn, L. Fischer, J. M. Pollok, B. Erbes, S. Seitz, and S. Urban. 2008. Prevention of hepatitis B virus infection in vivo by entry inhibitors derived from the large envelope protein. Nat. Biotechnol. 26:335-341. [PubMed]
28. Pizarro, J. C., B. Vulliez-le Normand, M. M. Riottot, A. Budkowska, and G. A. Bentley. 2001. Structural and functional characterization of a monoclonal antibody specific for the preS1 region of hepatitis B virus. FEBS Lett. 509:463-468. [PubMed]
29. Salisse, J., and C. Sureau. 2009. A function essential to viral entry underlies the hepatitis B virus “a” determinant. J. Virol. 83:9321-9328. [PMC free article] [PubMed]
30. Schulze, A., P. Gripon, and S. Urban. 2007. Hepatitis B virus infection initiates with a large surface protein-dependent binding to heparan sulfate proteoglycans. Hepatology 46:1759-1768. [PubMed]
31. Seeger, C., and W. S. Mason. 2000. Hepatitis B virus biology. Microbiol. Mol. Biol. Rev. 64:51-68. [PMC free article] [PubMed]
32. Sells, M. A., M. L. Chen, and G. Acs. 1987. Production of hepatitis B virus particles in Hep G2 cells transfected with cloned hepatitis B virus DNA. Proc. Natl. Acad. Sci. U. S. A. 84:1005-1009. [PubMed]
33. Tong, S., J. Li, and J. R. Wands. 1995. Interaction between duck hepatitis B virus and a 170-kilodalton cellular protein is mediated through a neutralizing epitope of the pre-S region and occurs during viral infection. J. Virol. 69:7106-7112. [PMC free article] [PubMed]
34. Urban, S. 2008. New insights into hepatitis B and hepatitis delta virus entry. Future Med. 3:253-264.
35. Urban, S., and P. Gripon. 2002. Inhibition of duck hepatitis B virus infection by a myristoylated pre-S peptide of the large viral surface protein. J. Virol. 76:1986-1990. [PMC free article] [PubMed]
36. Utsumi, T., K. Nakano, T. Funakoshi, Y. Kayano, S. Nakao, N. Sakurai, H. Iwata, and R. Ishisaka. 2004. Vertical-scanning mutagenesis of amino acids in a model N-myristoylation motif reveals the major amino-terminal sequence requirements for protein N-myristoylation. Eur. J. Biochem. 271:863-874. [PubMed]
37. Utsumi, T., M. Sato, K. Nakano, D. Takemura, H. Iwata, and R. Ishisaka. 2001. Amino acid residue penultimate to the amino-terminal Gly residue strongly affects two cotranslational protein modifications, N-myristoylation and N-acetylation. J. Biol. Chem. 276:10505-10513. [PubMed]

Articles from Journal of Virology are provided here courtesy of American Society for Microbiology (ASM)