PMCCPMCCPMCC

Search tips
Search criteria 

Advanced

 
Logo of nihpaAbout Author manuscriptsSubmit a manuscriptNIH Public Access; Author Manuscript; Accepted for publication in peer reviewed journal;
 
Biochem Biophys Res Commun. Author manuscript; available in PMC 2010 November 13.
Published in final edited form as:
PMCID: PMC2765659
NIHMSID: NIHMS147083
Reduction of a 4q35-Encoded Nuclear Envelope Protein in Muscle Differentiation
Cecilia Östlund,cd Tinglu Guan,a Denise A. Figlewicz,ef Arthur P. Hays,d Howard J. Worman,cd Larry Gerace,a and Eric C. Schirmerab
a Department of Cell Biology, Scripps Research Institute, La Jolla, CA 92037, USA
b Wellcome Trust Centre for Cell Biology, University of Edinburgh, Edinburgh EH9 3JR, UK
c Department of Medicine, College of Physicians and Surgeons, Columbia University, New York, NY 10032, USA
d Department of Pathology and Cell Biology, College of Physicians and Surgeons, Columbia University, New York, NY 10032, USA
e Department of Neurology, University of Michigan, Ann Arbor, MI 48109, USA
Corresponding author: Eric C. Schirmer, Wellcome Trust Centre for Cell Biology, University of Edinburgh, Kings Building Campus, Swann 5.22, Mayfield Road, Edinburgh EH9 3JR, UK, Phone: +44 131 650 7075, Fax: +44 131 650 7360, e.schirmer/at/ed.ac.uk
fpresent address: ALS Society of Canada, 265 Yorkland Boulevard, Suite 300, Toronto, Ontario M2J 1S5, Canada
Muscular dystrophy and peripheral neuropathy have been linked to mutations in genes encoding nuclear envelope proteins; however, the molecular mechanisms underlying these disorders remain unresolved. Nuclear envelope protein p19A is a protein of unknown function encoded by a gene at chromosome 4q35. p19A levels are significantly reduced in human muscle as cells differentiate from myoblasts to myotubes; however, its levels are not similarly reduced in all differentiation systems tested. Because 4q35 has been linked to facioscapulohumeral muscular dystrophy (FSHD) and some adjacent genes are reportedly misregulated in the disorder, levels of p19A were analyzed in muscle samples from patients with FSHD. Although p19A was increased in most cases, an absolute correlation was not observed. Nonetheless, p19A downregulation in normal muscle differentiation suggests that in the cases where its gene is inappropriately reactivated it could affect muscle differentiation and contribute to disease pathology.
Keywords: nuclear envelope, muscle differentiation, facioscapulohumeral muscular dystrophy, laminopathy
The nuclear envelope (NE) is a complex subdomain of the nucleus that is linked to multiple diseases including those affecting striated muscle. Mutations in LMNA, which encodes A-type lamins, cause several disorders characterized by dilated cardiomyopathy with variable skeletal muscle involvement, including Emery-Dreifuss muscular dystrophy (EDMD) and limb-girdle muscular dystrophy type 1B (LGMD1B) [1; 2; 3; 4]. Mutations in EMD encoding emerin cause X-linked EDMD [5]. The molecular mechanisms by which mutations in genes encoding NE proteins produce pathology in striated muscle remain unclear, but potential causes that are supported experimentally include mechanical instability of the nucleus, altered gene expression, disruption of cell signaling cascades, and failure of satellite cell function [4; 6]. This wide range of affected functions suggests that additional interacting NE proteins are involved in developing disease pathologies and implies that such partner proteins could be involved in additional muscle disorders.
Partner proteins could be among 67 previously uncharacterized nuclear membrane proteins identified by proteomics [7]. The human homolog of one of these proteins, p19A (initially called NET19), is encoded in the q35 region of chromosome 4 that is linked to fascioscapulohumeral muscular dystrophy (FSHD), one of the most common hereditary myopathies that has some clinical features similar to the NE-linked limb-girdle muscular dystrophy (type 1B), beginning with facial muscle degeneration but progressing to limb-girdle muscles and deltoids [3; 8]. FSHD is not associated with point mutations in any specific gene: rather, over >90% of cases correlate with a reduced number of D4Z4 repeats at 4q35. Wild-type alleles of some 4q35 genes are upregulated in the disease, though the molecular mechanism remains unresolved [9; 10; 11]. As p19A is located in 4q35 we considered that its misregulation might contribute to FSHD pathology. p19A levels were higher in some patients, but a clear correlation could not be made due to high variation among both control and patient samples. Strikingly, p19A protein levels are greatly reduced during muscle differentiation and absent from or expressed at low levels in adult muscle. Thus in those patients in which it is upregulated, p19A could contribute to muscle pathology.
Original Predicted NET19 Exons
Amino acid sequences predicted from each exon of the original orf XP_298567.
1:MKLELRVPVVLDVFTEMATLLTIITRLVNKWVDLWPRQENG
2:FILVSSWLTFLFSPGTLSVAMFCDTKWKTENIDLQLERRMEQR
3:CSMFLAVESTRTSAVVQEKPAGQGLCVRTAQWAVWSRFALSVRPELARTCRKLLRSSGGA
4:GHLRGSLASFRSRIELRRQIARPHAAGRETCCPLRRNHAGAPRLPSACSPEEVPVSRVLMRGLKRKRGRRARDPKGRGGEEETLALSFSCQQWQPPPQ
Antibody Generation
Peptides (3.5 mg each) representing four regions in the XP_298567 coding sequence (a = TRLVNKWVDLWPRQENGF, b = DTKWKTENIDLQLERRME, c = NHAGAPRLPSACSPEEVP, and d = LKRKRGRRARDPKGRGGE) were conjugated to keyhole limpet hemocyanin (KLH; 7 mg) with sulfo-SMCC (Pierce Chemical Co.; 1 mg). Free crosslinker was removed on a PD10 column (Pharmacia) and 500 μg of complexed peptide was emulsified with TiterMax Classic Adjuvant (Sigma) for injection 1 and Freund’s incomplete adjuvant (Sigma) for subsequent injections (3-week intervals) into New Zealand White rabbits. Actin antibodies (A-1978 Sigma) and lamin A (2962) and B1 (3931) antibodies [12] were previously described.
Cell Culture and Differentiation
All non-differentiation media contained 10% fetal calf serum, 100 μg/ml penicillin and 100 μg/ml streptomycin sulfate (Invitrogen). This was added to high glucose DMEM (Invitrogen) for HT1080, HeLa, COS-7, 293T and C2C12 cells, DMEM with MEM non-essential amino acids (Gibco) and 1 mM Na-Pyruvate (Gibco) for 3T3-L1 cells, RPMI (Gibco) for HL-60 and EL-4 cells, and SKGM (Cambrex, CC-3160) for primary myoblasts.
Myoblasts were isolated from patient and control samples using approved protocols and ethics considerations. Cultures were split and half was cultured in 2% horse serum medium for 6–9 days to differentiate into myotubes. Confluent C2C12 cells were differentiated in DMEM containing 0.1 % FCS, Na-pyruvate, 5 μg/ml insulin and 5 μg/ml transferrin. Two days post-confluent 3T3-L1 cells were differentiated with medium containing 1 μM dexamethasone, 0.5 mM 3-isobutyl-1-methylxanthine (IBMX), and 10 μg/ml insulin that was replaced after 2 days. At 4 days fresh medium containing just insulin was added. HL-60 cells (ATCC) were differentiated like macrophages with 10 nM TPA (phorbol 13 myristate acetate; Calbiochem) or like granulocytes with 1 μM trans-retinoic acid (Sigma).
For cell doubling measurements daily averages of at least 5 haemocytometer counts for suspension cultures and 20 grids on CELLocate coverslips (Eppendorf) were used to plot the number of cell divisions per unit time.
Subcellular Fractionation
Rat liver NEs and microsomes were isolated as previously detailed [13]. For salt extractions, 6 × 107 NEs were resuspended in 500 mM NaCl, 25 mM Tris pH 8.0, incubated on ice 15 min, and then centrifuged at 10,000 × g for 30 min to separate supernatant and pellet fractions. For alkali extractions, the NEs or microsomes were instead resuspended in 0.1 N NaOH, 0.01 M DTT and immediately centrifuged at 50,000 × g for 30 min. An equivalent percentage of supernatant and pellet were loaded onto gels.
Western Blotting
PVDF membranes were blocked in 10% milk, incubated with primary antibodies for 1 h, washed with 0.2% Tween-20, and incubated with anti-rabbit IgG-HRP 25 min followed by further washes. Membranes were then incubated in ECL (Pierce) 5 min and exposed to Biomax Light autoradiography film (Kodak).
A protein initially termed NET19 was identified by tandem mass spectrometry of a complex peptide mixture generated from a NE fraction [7]. Fragmentation spectra of the peptide yielded a high confidence match to the translated sequence (XP_298567) of hypothetical orf (XM_298567) located at 4q35 in the human genome encoding a 242 amino acid protein. This database entry was subsequently removed as several different contig assemblies rendered the precise sequence uncertain, presumably related to its proximity to the D4Z4 repeat sequences at 4q35. To test the validity of the original mass spectrometry identification four peptide antibodies were generated based on three of the four exons of the original annotated sequence that spanned roughly 40 Kb (Fig. 1A, B), all of which remained in the genomic sequence for 4q35 (AC093909, Homo sapiens BAC clone RP11-756P1). Antibodies to peptides from exons 1 and 2, 30 kb distant from one another, both recognized a 70 kDa band on Western blots of HeLa cells and rat liver NEs (Fig. 1C, left). In contrast, both antibodies to exon 4 peptides recognized a prominent 50 kDa protein in HeLa lysates, which was not clearly evident in rat liver NEs (Fig. 1C, right). Thus, the original predicted exons 1 and 2 encode parts of a 70 kDa protein, which we refer to as p19A, although they only account for 14% of its mass. Several attempts to amplify a fragment of p19A cDNA by PCR from a human liver cDNA library using various hypothetical exon combinations based on splice junction prediction algorithms were unsuccessful, so the complete sequence remains unknown. The original predicted exon 4 encodes part of a second 50 kDa protein, which we refer to as p19B.
Fig. 1
Fig. 1
The original NET19 hypothetical orf encompasses two different proteins. (A) NET19 genomic structure. 4q35 expansion showing scaled locations of several genes/motifs suggested to be involved in FSHD: ANT1 (x), FRG1 (y), FRG2 (z), D4Z4 repeats (d4), telomere (more ...)
The two proteins had very distinctive properties when tested for subcellular compartmentalization and membrane insertion. The p19A antibodies reacted with a NE fraction, but did not react with a microsome fraction on Western blots (Fig. 2A). In contrast the p19B antibodies reacted with a protein in the microsomes and failed to react with NEs. Thus, only p19A can be classified as a NE protein. Each confirmed p19A exon has a strongly predicted transmembrane segment by TMHMM version 2.0 [14]. To further characterize p19A membrane association, NEs were extracted with either 500 mM NaCl or 0.1 N NaOH and probed by Western blot with antibodies. LAP2β served as control, being a well-characterized integral nuclear membrane protein. Both p19A and LAP2β strongly resisted extraction with 500 mM salt; however almost no LAP2β was released from NEs with the alkali treatment, while most of the p19A was solubilized (Fig. 2B). The weaker membrane association is not inconsistent with membrane insertion as other NE transmembrane proteins have quite varied extraction properties [15; 16], but p19A might also be inserted as a “monotypic” protein that does not span the two bilayers.
Fig. 2
Fig. 2
p19A and p19B have different subcellular localizations. (A) Equal concentrations of rat liver NEs (NE) and microsomes (MM) were probed with antibodies to p19A (a, b) and p19B (c, d). Both p19A antibodies reacted only with NEs while both p19B antibodies (more ...)
As p19A and p19B are located in a chromosomal region linked to FSHD, we tested if, like some other genes at 4q35 [9; 10; 11], they are upregulated in FSHD patients. Myoblasts were isolated from four patient samples and controls that were coded so that analysis would be unbiased. All patients had <28 kb EcoRI fragments of the D4Z4 repeats, consistent with FSHD linked to reduced repeat number. Equivalent sample loading was based on Coomassie blue staining and confirmed by staining for actin and lamins. The p19A level was higher in three of the four patient samples than in all four controls and much higher than three controls (Fig. 3A). The p19A level in the fourth patient sample was still stronger than half of the controls. Thus, though upregulation of p19A could not be absolutely correlated with FSHD, correlation could be masked by the variable expression in both disease and control samples.
Fig. 3
Fig. 3
Protein levels of p19A are variable in primary human myoblasts and elevated levels cannot be clearly correlated with FSHD. (A) Myoblast lines from four FSHD patients (p) and controls (c) were tested for levels of p19A. In general, levels were increased (more ...)
To understand the extent of this variability, protein lysates from adult human muscle of FSHD patients and controls were probed for p19A. No p19A band was detectable in any of these samples, though it was readily detectable in Hela cell lysate loaded on the same gel (Fig. 3B, left). Furthermore, lamin protein was readily detectable in the muscle samples (Fig. 3B, right); so p19A should have been detectable if present. The absence of p19A in adult muscle and variable levels observed in isolated myoblasts suggested that p19A levels might be reduced in muscle differentiation. To test this hypothesis, myoblasts isolated from patient samples and controls were induced to differentiate into myotubes by serum withdrawal, similar amounts of total protein were run on gels, and p19A was detected by immunoblotting (Fig. 3C). In every instance, regardless of the variable starting levels, the levels of p19A dropped precipitously upon differentiation. In contrast p19B levels were essentially unchanged.
One possible explanation for the variability in basal levels of p19A in myoblasts was suggested by the observation that those with lower levels took much longer to double than those with higher levels. To test if higher p19A protein levels correlate to a faster cell doubling time, protein lysates from a variety of cell lines with different doubling times were compared for levels of p19A, p19B, and lamin B1 (Fig. 4A). However, in contrast to primary myoblasts, immortalized cell lines with shorter doubling times did not have higher levels of p19A. 293T and EL-4 cells, which had respective doubling times of 11 and 14 h, had very low p19A levels. In contrast, HT1080, HeLa, COS7, and 3T3-L1 cells which all doubled at >20 h expressed high levels of p19A (Fig. 4A, B). Levels were also high in C2C12 cells (doubling time, 19 h). In contrast, levels of p19B were similar in all lines except the suspension EL-4 cells.
Fig. 4
Fig. 4
p19A disappears during differentiation in certain in vitro systems. (A) Levels of p19A are lower in more rapidly dividing cell lines. Protein lysates from various cell lines were loaded on gels after levels were equilibrated with Coomassie staining and (more ...)
To test if p19A loss is a general characteristic of cellular differentiation, p19A levels were also measured in four in vitro differentiation systems: muscle (C2C12), adipocyte (3T3-L1), macrophage-like (HL-60), and granulocyte-like (HL-60). Levels of p19A dropped below the level of detection during C2C12 differentiation and to very low levels during 3T3-L1 differentiation (Fig. 4B). As serum is not reduced in 3T3-L1 differentiation, the loss of p19A is not related to serum withdrawal employed to differentiate myoblasts to myotubes. Another variable is introduced with HL-60 cells, which in contrast to the other lines are grown in suspension. When treated with retinoic acid, they withdraw from the cell cycle and differentiate along a granulocytic pathway while remaining in suspension [17]. When treated with phorbol esters, they adhere to a substratum and spread as they acquire macrophage-like characteristics [17]. The levels of p19A were maintained during the granulocytic differentiation (Fig. 4C, dg), while they were dramatically reduced during the macrophage-like differentiation (Fig. 4C, dm). As cells in both differentiation paradigms withdraw from the cell cycle, the loss of p19A in just the macrophage-like differentiation appears to be unrelated to withdrawal from the cell cycle. The only shared characteristic of all differentiation systems in which p19A was lost is that the cells underwent significant morphological changes (myoblast fusion, fat deposition, substratum adherence and spreading).
This suggests that p19A may be involved in a nuclear function that must be removed to enable tissue remodeling. The morphological changes in these differentiation systems would require repositioning of nuclei and restructuring of nucleo-cytoskeletal connections as overall cell shape changes. As p19A was most completely lost in muscle differentiation it is tempting to speculate that failure to remove p19A might prevent satellite cells from differentiating to replace damaged muscle. Such an effect could contribute to the pathophysiology of FSHD in the patients who exhibited upregulation of p19A.
The mechanism underlying the pathophysiology of FSHD remains contentious, but it is generally agreed that loss of D4Z4 repeats and consequent changes in the epigenetic makeup of the surrounding region are significant factors, likely affecting the expression of multiple genes [18]. Until the complete p19A gene can be cloned it will not be possible to form a detailed molecular model for how it might contribute to FSHD or other disorders. However, it is intriguing that this is the first 4q35-encoded protein in NEs. A potential link between FSHD and the NE came from observations that the 4q telomere occurs preferentially at the nuclear periphery [19] and is associated with peripheral heterochromatin [20]. This finding is interesting in relation to the idea of a position effect in FSHD; however, the position effect might relate to proximity to the epigenetically silent environment of the NE [21; 22] if a threshold number of D4Z4 repeats is required for NE tethering. NE tethering of 4q35 might also explain why only reduction in D4Z4 repeats at 4q35 causes FSHD while reduction in other D4Z4 repeats at 10q26 has no disease correlation [23].
The considerable clinical variability of both FSHD and the laminopathies LGMD1B and EDMD is consistent with the high degree of variability in expression levels for p19A observed here. Thus whatever the precise role of p19A in cellular/tissue remodeling and 4q tethering to the periphery, p19A is a reasonable candidate to influence the pathology of FSHD or muscle laminopathies if inappropriately expressed in adult cells.
Acknowledgments
We would like to thank bioinformatician Alastair Kerr for an extensive analysis of the genome region encoding p19A. This work was supported by a Wellcome Trust Senior Research Fellowship to ECS, NIGMS grants to LG, Muscular Dystrophy Association Research Development Grant (MDA3859) to CO, and grants from the Muscular Dystrophy Association (MDA3711) and National Institutes of Health (AR048997) to HJW.
Footnotes
This is a PDF file of an unedited manuscript that has been accepted for publication. As a service to our customers we are providing this early version of the manuscript. The manuscript will undergo copyediting, typesetting, and review of the resulting proof before it is published in its final citable form. Please note that during the production process errors may be discovered which could affect the content, and all legal disclaimers that apply to the journal pertain.
1. Bonne G, Di Barletta MR, Varnous S, Becane HM, Hammouda EH, Merlini L, Muntoni F, Greenberg CR, Gary F, Urtizberea JA, Duboc D, Fardeau M, Toniolo D, Schwartz K. Mutations in the gene encoding lamin A/C cause autosomal dominant Emery-Dreifuss muscular dystrophy. Nat Genet. 1999;21:285–8. [PubMed]
2. Fatkin D, MacRae C, Sasaki T, Wolff MR, Porcu M, Frenneaux M, Atherton J, Vidaillet HJ, Jr, Spudich S, De Girolami U, Seidman JG, Seidman C, Muntoni F, Muehle G, Johnson W, McDonough B. Missense mutations in the rod domain of the lamin A/C gene as causes of dilated cardiomyopathy and conduction-system disease. N Engl J Med. 1999;341:1715–24. [PubMed]
3. Muchir A, Bonne G, van der Kooi AJ, van Meegen M, Baas F, Bolhuis PA, de Visser M, Schwartz K. Identification of mutations in the gene encoding lamins A/C in autosomal dominant limb girdle muscular dystrophy with atrioventricular conduction disturbances (LGMD1B) Hum Mol Genet. 2000;9:1453–1459. [PubMed]
4. Worman HJ, Bonne G. “Laminopathies”: a wide spectrum of human diseases. Exp Cell Res. 2007;313:2121–33. [PMC free article] [PubMed]
5. Bione S, Maestrini E, Rivella S, Mancini M, Regis S, Romeo G, Toniolo D. Identification of a novel X-linked gene responsible for Emery-Dreifuss muscular dystrophy. Nat Genet. 1994;8:323–7. [PubMed]
6. Bridger JM, Foeger N, Kill IR, Herrmann H. The nuclear lamina. Both a structural framework and a platform for genome organization. FEBS J. 2007;274:1354–61. [PubMed]
7. Schirmer EC, Florens L, Guan T, Yates JRr, Gerace L. Nuclear membrane proteins with potential disease links found by subtractive proteomics. Science. 2003;301:1380–1382. [PubMed]
8. Kissel JT. Facioscapulohumeral dystrophy. Semin Neurol. 1999;19:35–43. [PubMed]
9. Tupler R, Perini G, Pellegrino MA, Green MR. Profound misregulation of muscle-specific gene expression in facioscapulohumeral muscular dystrophy. Proc Natl Acad Sci U S A. 1999;96:12650–4. [PubMed]
10. van Overveld PG, Lemmers RJ, Sandkuijl LA, Enthoven L, Winokur ST, Bakels F, Padberg GW, van Ommen GJ, Frants RR, van der Maarel SM. Hypomethylation of D4Z4 in 4q-linked and non-4q-linked facioscapulohumeral muscular dystrophy. Nat Genet. 2003;35:315–317. [PubMed]
11. Gabriels J, Beckers MC, Ding H, De Vriese A, Plaisance S, van der Maarel SM, Padberg GW, Frants RR, Hewitt JE, Collen D, Belayew A. Nucleotide sequence of the partially deleted D4Z4 locus in a patient with FSHD identifies a putative gene within each 3.3 kb element. Gene. 1999;236:25–32. [PubMed]
12. Schirmer EC, Guan T, Gerace L. Involvement of the lamin rod domain in heterotypic lamin interactions important for nuclear organization. J Cell Biol. 2001;153:479–489. [PMC free article] [PubMed]
13. Florens L, Korfali N, Schirmer EC. Subcellular fractionation and proteomics of nuclear envelopes. Methods Mol Biol. 2008;432:117–37. [PubMed]
14. Krogh A, Larsson B, von Heijne G, Sonnhammer EL. Predicting transmembrane protein topology with a hidden Markov model: application to complete genomes. J Mol Biol. 2001;305:567–80. [PubMed]
15. Foisner R, Gerace L. Integral membrane proteins of the nuclear envelope interact with lamins and chromosomes, and binding is modulated by mitotic phosphorylation. Cell. 1993;73:1267–79. [PubMed]
16. Dreger M, Bengtsson L, Schoneberg T, Otto H, Hucho F. Nuclear envelope proteomics: novel integral membrane proteins of the inner nuclear membrane. Proc Natl Acad Sci U S A. 2001;98:11943–8. [PubMed]
17. Collins SJ. The HL-60 promyelocytic leukemia cell line: proliferation, differentiation, and cellular oncogene expression. Blood. 1987;70:1233–1244. [PubMed]
18. Dmitriev P, Lipinski M, Vassetzky YS. Pearls in the junk: dissecting the molecular pathogenesis of facioscapulohumeral muscular dystrophy. Neuromuscul Disord. 2009;19:17–20. [PubMed]
19. Masny PS, Bengtsson U, Chung SA, Martin JH, van Engelen B, van der Maarel SM, Winokur ST. Localization of 4q35.2 to the nuclear periphery: is FSHD a nuclear envelope disease? Hum Mol Genet. 2004;13:1857–71. [PubMed]
20. Tam R, Smith KP, Lawrence JB. The 4q subtelomere harboring the FSHD locus is specifically anchored with peripheral heterochromatin unlike most human telomeres. J Cell Biol. 2004;167:269–79. [PMC free article] [PubMed]
21. Somech R, Shaklai S, Geller O, Amariglio N, Simon AJ, Rechavi G, Gal-Yam EN. The nuclear-envelope protein and transcriptional repressor LAP2beta interacts with HDAC3 at the nuclear periphery, and induces histone H4 deacetylation. J Cell Sci. 2005;118:4017–25. [PubMed]
22. Ye Q, Worman HJ. Interaction between an integral protein of the nuclear envelope inner membrane and human chromodomain proteins homologous to Drosophila HP1. J Biol Chem. 1996;271:14653–6. [PubMed]
23. Tawil R, Van Der Maarel SM. Facioscapulohumeral muscular dystrophy. Muscle Nerve. 2006 [PubMed]