PMCCPMCCPMCC

Search tips
Search criteria 

Advanced

 
Logo of nihpaAbout Author manuscriptsSubmit a manuscriptNIH Public Access; Author Manuscript; Accepted for publication in peer reviewed journal;
 
Mol Cell. Author manuscript; available in PMC 2009 July 11.
Published in final edited form as:
PMCID: PMC2522368
NIHMSID: NIHMS59842
Structural basis for the autoinhibition of talin in regulating integrin activation
Esen Goksoy,1,3# Yan-Qing Ma,1,2# Xiaoxia Wang,1 Xiangming Kong,1 Dhanuja Perera,1 Edward F. Plow,1,2 and Jun Qin1,3*
1Department of Molecular Cardiology, Lerner Research Institute, Cleveland Clinic, 9500 Euclid Ave., Cleveland, OH 44195
2Joseph J. Jacobs Center for Thrombosis and Vascular Biology, Lerner Research Institute, Cleveland Clinic, 9500 Euclid Ave., Cleveland, OH 44195
3Department of Biological, Geological, and Environmental Sciences, Cleveland State University, OH 44195
*To whom correspondence should be addressed: Jun Qin, Structural Biology Program, Department of Molecular Cardiology, NB20, Lerner Research Institute, Cleveland Clinic, 9500 Euclid Ave., Cleveland, OH 44195, (216)-444-5392 (Phone), (216)-445-1466 (Fax), qinj/at/ccf.org (E-mail)
#:denotes equal contribution
Activation of heterodimeric (α/β) integrin transmembrane receptors by the 270 kDa cytoskeletal protein talin is essential for many important cell adhesive and physiological responses. A key step in this process involves interaction of phosphotyrosine-binding (PTB) domain in the N-terminal head of talin (talin-H) with integrin β membrane-proximal cytoplasmic tails (β-MP-CTs). Compared to talin-H, intact talin exhibits low potency in inducing integrin activation. Using NMR spectroscopy, we show that the large C-terminal rod domain of talin (talin-R) interacts with talin-H and allosterically restrains talin in a closed conformation. We further demonstrate that talin-R specifically masks a region in talin-PTB where integrin β-MP-CT binds and competes with it for binding to talin-PTB. The inhibitory interaction is disrupted by a constitutively activating mutation (M319A) or by phosphatidylinositol 4,5-bisphosphate, a known talin activator. These data define a distinct autoinhibition mechanism for talin and suggest how it controls integrin activation and cell adhesion.
Keywords: Talin, autoinhibition, integrin activation, NMR
Talin is a high molecular weight protein containing an N-terminal head (1-433, talin-H, 50 kDa) and a C-terminal rod domain (434-2541, talin-R, 220 kDa) (Figure 1A) (Rees et al, 1990). Talin-H is globular, containing a FERM domain composed of three lobes, F1, F2, and F3 or phosphotyrosine-binding (PTB) domain (Garcia-Alvarez et al., 2003); talin-R is highly elongated, containing a series of helical bundles separated by linkers (McLachlan et al., 1994; Papagrigoriou et al., 2004; Fillingham et al., 2005; Gingras et al., 2008). Discovered in high concentrations at regions of cell-substratum contact (Burridge and Connell, 1983), talin has long been known to be a physical linker between integrins and the actin cytoskeleton, and a regulator of a variety of cellular processes such as cell spreading, migration, and proliferation (Turner and Burridge, 1991; Calderwood et al., 2000). Recent advances have revealed an additional and especially important role for talin: by binding to integrin β CTs, talin induces high affinity ligand binding to integrins, integrin activation (Tadokoro et al., 2003; Wegener et al., 2007), a major step in cell adhesion, migration, and numerous physiological and pathophysiological responses (for review, see Hynes, 2002). A surge of genetic, cell biological and biochemical experiments has now established that talin F3, the PTB domain of talin-H, plays a dominant role in inducing the integrin activation (Calderwood et al., 2002; Tadokoro et al., 2003; Ma et al., 2006; Wegener et al., 2007). Structural analyses have shown that talin-PTB binds to both membrane-distal and membrane-proximal regions of integrin β CTs (Vinogradova et al., 2002, 2004; Garcia-Alvarez et al., 2003; Ulmer et al., 2003; Wegener et al., 2007), and the latter event causes integrin activation by unclasping the integrin α/β CT complex (Vinogradova et al., 2002, 2004; Kim et al., 2003; Wegener et al., 2007).
Figure 1
Figure 1
Effects of full length talin and talin-H on integrin activation. (A) Domain organization of full length talin. The three lobes of talin-H FERM domain, F1, F2, F3 or PTB and the rod domain have been labeled. (B) Comparison of the activation of integrin (more ...)
With rapidly accumulating in vitro (see review, Calderwood, 2004) and in vivo (Nieswandt et al., 2007; Petrich et al., 2007) data demonstrating the central role of talin in integrin activation, a fundamental question still remains: how is talin activity regulated? Previous functional analyses have suggested that talin activity may be autoinhibited for binding to integrins (Martel et al., 2001; Yan et al., 2001). However, this mechanism remains largely speculative and the structural basis for such autoinhibition and how it impacts integrin activation have not been established.
Here, we use structural, biochemical, and mutational analyses to pinpoint the molecular details of the talin regulation. Intact talin, but not its talin-H fragment, has low intrinsic integrin activating activity, directly supporting the notion that talin adopts a default inactive conformation. By performing extensive NMR-based structural analyses, we show that a middle segment of talin-R specifically interacts with talin-FERM and competes with integrin β CT for binding to talin-PTB. Mutations of key residues in talin-PTB involved in binding to integrin β CT revealed that talin-R specifically masks the integrin membrane-proximal β CT binding site on talin-PTB that is key for controlling the cytoplasmic unclasping and activation of integrins. A structure-based mutation on talin-PTB, which does not affect talin-H/integrin interaction but disrupts the talin-H/talin-R interaction, leads to constitutive activation of full length talin. Phosphatidylinositol 4,5-bisphosphate (PIP2), a known talin activator (Martel et al., 2001), disrupts the inhibitory talin-PTB/talin-R interaction. These results define a novel structural mechanism of the talin autoinhibition and suggest how it may serve as a specific cellular brake to control integrin activation.
Talin adopts a default low activity state for regulating integrin activation
It is well-established that talin-H can activate integrins (Calderwood et al., 1999, 2002; Tadokoro et al., 2003; Kim et al., 2003; Ma et al., 2006; Bouaouina et al., 2007), and it is presumed that this activity is blunted in full length talin. To directly compare the integrin activating activity of these two talin forms, we transfected vectors expressing full length talin or talin-H, all as EGFP constructs, into a CHO cell line stably expressing integrin αIIbβ3IIbβ3-CHO). The activation state of the αIIbβ3 was then measured by the binding of an activation-specific mAb to αIIbβ3 antibody (PAC1) by FACS. To eliminate the influence of varied expression of talin-H and full length talin, only EGFP positive cells with similar expression levels were gated. The data in Figure 1B are from three independent experiments and show that, while talin-H induced substantial activation of αIIbβ3 activation, full-length talin was significantly weaker as an activator. Thus, our data provide direct functional evidence for the supposition that integrin activation by full-length talin is dampened and is enhanced by events that change exposure of its head region.
A middle segment of Talin-R (1654-2344) interacts with talin-PTB in talin-FERM
Since talin-PTB (F3) in talin-H is solely responsible for binding to integrin β CTs during integrin activation (Calderwood et al., 2002; Garcia-Alvarez et al., 2003; Tadokoro et al., 2003; Wegener et al., 2007), we reasoned that talin-R might mask the integrin β CT binding site. To test this hypothesis, we used NMR-based 2D 1H-15N HSQC (heteronuclear single quantum correlation) experiments to examine the interaction between 15N-labeled talin-PTB and unlabeled talin-R fragments. 2D 1H-15N HSQC is extremely sensitive for probing protein-target interactions with a wide range of affinities (Bonvin et al., 2005; Vaynberg and Qin, 2006; Takeuchi and Wagner, 2006). The HSQC spectrum of an 15N-labeled protein contains many peaks, each peak correlates to a proton attached to 15N within a particular residue in the protein. Some peaks may be shifted or broadened in the HSQC spectrum if the protein is bound to a target, an excellent indication of the binding interface. The peak broadening or disappearance can be due to the size increase or intermediate rate exchange of the protein complex at the NMR time scale. If any of the unlabeled talin-R fragments binds to 15N-labeled talin-PTB, some or all 1H/15N amide signals of talin-PTB should be perturbed and broadened, which in turn provides information on the intramolecular interaction between talin-PTB and talin-R. Based on the available helical bundle structure of talin-R (Papagrigoriou et al., 2004; Fillingham et al., 2005; Gingras et al., 2008) and a secondary structure prediction program (Bryson et al., 2005), we dissected talin-R into nine consecutive fragments (R1:434-947, R2:944-1483, R3:1482-1653, R4: 1654-1848, R5: 1841-1983, R6: 1984-2102, R7: 2103-2229, R8:2225-2344, and R9: 2338-2541), where the division regions were predicted to be random coil or loop structures so the structural integrities of these fragments should be preserved. A series of HSQC spectra were collected for 15N-labeled talin F2F3 domain, which contains talin-PTB (F3), in the absence and presence of individual unlabeled talin-R fragments. Starting from the N-terminus of talin-R, we found that R1, R2, R3 had little effect on the HSQC spectrum of talin-F2F3 (see supplementary Figure S1A-S1C) whereas R4 (~21 kDa) caused significant line-broadening of talin-F2F3 (~22 kDa) (supplementary Figure S1D), suggesting that R4 binds to talin-F2F3. From the C-terminus, R9 did not bind (supplementary Figure S1E) but R8 caused significant line-broadening of talin-F3F3, suggesting that it also interacts with talin-F2F3 (supplementary Figure S1F). These initial mapping data indicated that talin-R does interact with talin-F2F3 and the binding site involves multiple regions, R4 and R8, but not the N-terminal R1-R3 and C-terminal R9. Based on these initial data, we then prepared another larger expression construct encompassing R4 and R8, i.e., 1654-2344, with a total molecular weight of ~76 kDa (termed talin-RM). Talin-RM was well-folded as assessed by its chemical shift dispersion pattern (supplementary Figure S2). As predicted, talin-RM also bound to talin F2F3, as indicated by the substantial line-broadening and disappearance of talin F2F3 signals in HSQC (MW~100 kDa) (data not shown). By employing a TROSY technique (Transverse Relaxation Optimized Spectroscopy) into HSQC, which is tailored for detecting NMR signals of large proteins and protein complexes (Pervusin et al., 1997), we were able to recover the majority of signals, some of which were significantly shifted due to binding (Figure 2A).
Figure 2
Figure 2
The binding of talin-RM to talin-F2F3. (A). 2D TROSY 1H-15N HSQC of talin-F2F3 in the absence (black) and presence of unlabeled talin-RM (red). Well resolved peaks, which are either significantly broadened or shifted, are labeled in free form talin-F2F3. (more ...)
To understand the nature of this interaction, we performed backbone signal assignments of talin F2F3 using triple resonance NMR, including HNCACB, CBCACONH, HNCA, HNCO, HC(CO)NH, and C(CO)NH (Bax and Grazsiek, 1993). Table S1 lists the chemical shift assignments of this construct. Chemical shift mapping revealed that only NMR signals of F3 (PTB) but not F2 in talin F2F3 were either significantly shifted or broadened (Figure 2B), thus supporting our hypothesis that talin-PTB binds to talin-RM. To improve the spectral quality and simplify the spectral analysis, we made 15N/2H-labeled talin-PTB and performed its TROSY-HSQC in complex with the unlabeled talin-RM (total complex is ~90 kDa). Both deuteration and TROSY are known to dramatically reduce the line-broadening of the proteins, which led to an excellent and well-resolved spectrum of talin-PTB bound to unlabeled talin-RM (Figure S3A). As expected, talin-RM caused significant chemical shift perturbation for talin-PTB (Figure S3A). Surface plasmon resonance (SPR) experiments revealed that the dissociation constant (KD) between talin-PTB and talin-RM is 577 nM (Table 1 and supplementary Figure S3B).
Table 1
Table 1
KD of the talin RM or smaller fragments binding to talin-PTB and talin-PTB mutants
Talin-RM and integrin membrane-proximal β3 CT compete for an overlapping binding site on talin-PTB
To precisely map the talin-RM binding site on talin-PTB, we performed a series of NMR titration experiments. TROSY-HSQC spectra were collected for 15N/2H-labeled talin-PTB in the absence and presence of increasing concentrations of talin-RM to obtain molar ratios of 1:0.0, 1:0.5, 1:1.0, and 1:2. This experimental design allowed us to trace the significantly perturbed signals (Figure S3A). Figure 3A shows the detailed chemical shift perturbation profile. Remarkably, the perturbation pattern was similar to that previously reported for integrin β3 CT or integrin membrane-proximal β3 CT segment fused to PIPKIγ peptide (Wegener et al., 2007) (Figure 3A), suggesting that the talin-RM binding site on talin-PTB overlaps with that for integrin β3 CT. Interestingly, chemical shift mapping revealed that talin-R4 (1654-1848) also induced very similar perturbation profile (Figure S4A vs 4B), albeit with slightly reduced chemical shift changes and lower affinity (KD~3.6μM, Table 1) than talin-RM (KD~0.58μM, Table 1). On the other hand, a larger fragment containing C-terminal talin-RM (R6-R8, 1984-2344), induced different and very narrow-range chemical shift changes peaking around 367-375 (Figure S4C) with much lower affinity (KD~78.0μM, Table 1) than talin-RM. Combining these two fragments in a single construct (talin-RM) yields higher affinity (0.58μM, see Table 1). These data suggest that R4 and R6-R8 bind to different regions in talin-PTB and that R4 plays more important role in binding to talin-PTB (see more data below). Figure 3B highlights significantly shifted residues in talin-PTB upon binding to talin-RM and integrin β3 CT chimera, respectively, thus providing more direct view of how the two binding sites might overlap.
Figure 3
Figure 3
Mapping of the talin-RM binding site on talin-PTB. (A) 1H/15N Chemical shift changes of talin-PTB upon binding to talin-RM as a function of residue number. As a comparison, the chemical shift changes of talin-PTB upon binding to β3 CT chimera (more ...)
To more precisely evaluate how the integrin β3 CT binding sites on talin-PTB may be involved in binding to talin-RM, we introduced a series of structure-based talin-PTB point mutations L325R, W359A, S365D, S379R, Q381V, each has been previously shown to impair the talin-mediated integrin activation without affecting the structural integrity of talin-PTB (Wegener et al., 2007). L325R, S365D, S379R, and Q381V disrupt the integrin β membrane-proximal CT binding to talin-PTB whereas W359A abolishes the integrin CT binding to talin-PTB by removing the bulky interaction of the membrane-distal CT with talin-PTB (Wegener et al., 2007). We also made the M319A mutant. M319 is a surface-exposed hydrophobic residue that is not involved in interacting with either integrin β3 membrane-proximal region (Wegener et al., 2007) or membrane-distal region (Garcia-Alvarez et al., 2003), and thus its mutation to Ala had little effect on the interaction with integrin β3 CT chimera (Figure S5). However, M319 is most significantly perturbed by talin-RM (Figure 3A), suggesting that it may play a crucial role in interacting with talin-RM. Table 1 summarizes the KD values of talin-RM binding to WT talin-PTB, M319A, L325R, W359A, S365D, S379R, and Q381V by SPR. Compared to wild type talin-PTB, S365D, S379R, and Q381V exhibited markedly reduced binding to talin-RM, whereas L325R had very small effect. As expected, while M319A still binds to integrin β3 CT as WT talin-PTB (Figure S5A vs S5B), it had dramatically weakened interaction (~140 fold) with talin-RM (Table 1).
The effects of S365D, S379R, and Q381V recapitulate those for binding to the integrin membrane-proximal β3 CT and indicate that this site significantly overlaps with that for talin-RM in the talin-PTB domain. To confirm this conclusion, we prepared large quantities of two representative mutants in 15N/2H-labeled form, S365D (reduced binding to talin-RM by ~2.9×103 fold). and Q381V (reduced binding to talin-RM by ~540 fold) (Table 1) and examined their chemical shift perturbation in the absence and presence of unlabeled talin-RM. Consistent with the SPR data, the extent of the chemical shift changes was decreased for Q381V and much more decreased for S365D as compared to WT talin-PTB (Figure 4).
Figure 4
Figure 4
Chemical shift perturbation profiles for WT talin-PTB and its mutants Q381V and S365D by talin-RM. Note that the chemical shifts are attenuated with the Q381V mutant but are still similar to WT, whereas they are dramatically reduced with the S365D mutant. (more ...)
Interestingly, W359A, which completely abolished the talin-PTB binding to integrin β3 CT by disrupting the bulky hydrophobic interaction between talin-PTB and membrane-distal β3 CT (Garcia-Alvarez et al., 2003; Wegener et al., 2007), had little effect on the KD of the talin-PTB/talin-RM interaction (Table 1). This observation, together with the above described effects of other mutants, suggests that the binding sites on talin-PTB for talin-RM and integrin β3 CT are overlapping but not identical. To further investigate this possibility, we performed HSQC-based competition experiments. As shown in Figure S6A and S6B, while the majority of signals disappear from 15N-labeled talin-PTB upon binding to the large talin-RM (total MW~90 kDa, KD~577nM, see Table 1), these signals return upon addition of equal molar β3 CT chimera (β3 membrane-proximal CT fused to PIPKIγ peptide, MW~3.5 kDa, KD~140nM, see Wegener et al., 2007), yielding a spectrum identical to that for 15N-labeled talin-PTB bound to the unlabeled β3 CT chimera (Figure S6C). These data demonstrate that the small β3 CT chimera peptide competed with large talin-RM for binding to talin-PTB. In contrast, excess PIPKIγ peptide, which mimics the β3 membrane-distal CT binding and binds tightly to talin-PTB (KD~270nM) (de Perera et al., 2005), did not recover the broadened signals at all (Figure S6D), indicating that PIPKIγ and talin-RM do not have overlapping binding sites on talin-PTB. Since PIPKIγ mimics the β3 membrane-distal CT for binding to talin-PTB (de Pereda et al., 2005; Kong et al., 2006; Wegener et al., 2007), our NMR data are in agreement with our SPR data on W359A mutant (Table 1) indicating that while the integrin membrane-proximal CT binding site is significantly masked by talin-RM, the β3 membrane-distal CT binding site for talin-PTB is not. Consistently, a F730A mutant in the chimera peptide, which has dramatically reduced membrane-proximal β3 CT binding to talin-PTB (Wegener et al., 2007), did not compete effectively with talin-RM (Figure S7A vs S7B). Note that the β3 CT also binds to talin-RM (Tremuth et al., 2004). However, such binding does not appear to interfere with the talin-PTB/talin-RM interaction since β3 CT did not affect the talin-RM interaction with talin-PTB W359A (Figure S8). Note that W359A has the same affinity for talin-RM as WT talin-PTB (Table 1) but does not bind to β3 CT (Wegener et al., 2007).
NMR-based competition experiments also revealed that talin-R4 (Figure S9A) but not talin-R6-R8 (Figure S9B) competed with β3 CT chimeria for binding to talin-PTB. Since talin-R4 induced very similar chemical shift perturbations as talin-RM when binding to talin-PTB (Figure S4), this finding suggests that talin-R4 plays a major role in masking the membrane-proximal CT binding site on talin-PTB. It also further supports our prior chemical shift mapping and affinity-based results that talin-R4 and talin-R6-R8 bind to different regions of talin-PTB. Figure 5A summarizes the surface depiction of the talin-PTB structure in which key residues directly involved in binding to talin-RM are highlighted based on the chemical shift mapping, mutagenesis and competition data. The binding surface is compared to that for the talin-PTB/integrin β CT complex (Figure 5B) (Wegener et al., 2007) and shows that the membrane-proximal β3 CT binding site significantly overlaps with that for talin-RM, thus providing a view of how talin-R may sterically suppress the β CT binding to talin-PTB in intact talin.
Figure 5
Figure 5
Talin autoinhibition and its effect on integrin activation. (A) Surface representation of talin-PTB domain with the talin-RM binding site highlighted. Residues whose mutations impair talin-RM binding are colored in green whereas other potential binding (more ...)
To further evaluate the significance of the talin autoinhibition, we examined the activity of talin M319A in integrin activation. Since this mutant still maintains the integrin binding (Figure S5) but has dramatically reduced the talin-PTB/talin-RM affinity (Table 1), we speculated that full length talin M319A would activate the integrin. As shown in Figure 5C, M319A indeed dramatically enhanced talin induced αIIbβ3 activation as compared to WT talin. This enhancement was abolished by RGDS peptide, a inhibitor of ligand binding to β3 integrins (data not shown), indicating specificity. Thus, this observation offers strong support for our hypothesis. Note that the M319A-induced integrin activation is even more potent than talin-H. While the precise mechanism for this higher potency remains to be determined, one can envision two possibilities: (i) Full length talin M319A has higher affinity to integrin than talin-H alone thus leading to the more potent integrin activation. In addition to talin-H, isolated talin-R also binds to integrin β CT (Xing et al., 2001; Yan et al., 2001; Tremuth et al., 2004) at the membrane-distal region (Tremuth et al., 2004) but not the membrane-proximal site (Goksoy and Qin, data not shown). Thus, the constitutively open conformation of M319A may have higher affinity for integrin than talin-H alone due to both talin-H (M319A)/integrin and talin-R/integrin interactions. (ii) Membrane-anchoring of talin is important for integrin activation (Vinogradova et al., 2004; Wegener et al., 2007). It is possible that the open conformation of M319A has stronger capacity to anchor to the membrane than talin-H alone, resulting in more potent integrin activation.
Conformational activation by PIP2
Given the above findings, an obvious question is how the closed conformation of talin is opened. A well-known talin activator is phosphatidylinositol 4,5-bisphosphate (PIP2), which promotes strong talin binding to integrin β CT (Martel et al., 2001), resulting in the formation of a ternary PIP2/talin/integrin complex in living cells for mediating integrin activation and clustering (Cluzel et al., 2005). Our SPR experiment revealed that talin-H, but not talin-RM, can potently bind to biotinylated PIP2 with high affinity (KD~89.2±1.25nM, Figure S10A). The biotinylated PIP2 was mounted on a biotin sensor chip, and such positioned PIP2 should mimic PIP2 anchored to the membrane. Since talin-H FERM domain and multiple FERM domains bind to PIP2 involving PTB/PH subdomains (Hamada et al., 2000; Bompard et al., 2003; Cai et al., 2008), we considered if talin-PTB is involved in binding PIP2. Our HSQC-based mapping experiment revealed that PIP2 can indeed interact with talin-PTB with the most significant perturbation around 370-378 (Figure S10B), which overlaps with the talin-RM binding site (Figure 5D). SPR experiments demonstrated that PIP2 can disrupt the talin-RM/talin-PTB interaction in a concentration-dependent manner (Figure 6A). Such competition was confirmed by HSQC experiments where soluble C4-PIP2 was able to compete with talin-RM for binding to talin-PTB (Figure 6B). Since PIP2/talin-H interaction has been shown not to interfere with the talin-H/integrin interaction (see Figure 6 in Martel et al., 2001) and instead it induces conformational change of talin for high affinity integrin binding (Martel et al., 2001), our findings provide a mechanism by which PIP2 binds to talin-PTB and sterically displaces the inhibitory talin-R to expose the integrin binding site.
Figure 6
Figure 6
PIP2 disrupts the inhibitory talin-PTB/talin-RM interaction. (A) SPR showing that C8-PIP2 (echelon Bioscience, Inc) suppresses the talin-PTB interaction with talin-RM in a concentration dependent manner. Talin-RM was immobilized on the activated chip. (more ...)
A combination of NMR spectroscopy, mutagenesis, and biochemical experiments have revealed how talin-FERM via its PTB subdomain interacts with talin-R to restrain talin in an inactive/autoinhibited conformation. Autoinhibition is a widespread phenomenon in controlling protein functions and occurs in multiple FERM-containing proteins (Pearson et al., 2000; Li et al., 2007; Lietha et al., 2007). However, only the talin FERM domain can directly mediate integrin activation (Tadokoro et al., 2003) by binding to the integrin membrane-proximal β CT (Vinogradova et al., 2002; Wegener et al., 2007). The masking of the integrin membrane-proximal β CT binding site in talin-FERM by talin-R is quite unique as compared to other autoinhibitory FERM-containing proteins, which utilize FERM domains to autoinhibit the functions of other parts of proteins (Pearson et al., 2000; Li et al., 2007; Lietha et al., 2007). For example, focal adhesion kinase (FAK) utilizes its N-terminal FERM F2 domain to mask the C-terminal kinase active site (Lietha et al., 2007) whereas moesin uses its N-terminal FERM F2 and F3 subdomains to mask its C-terminal actin binding site. Thus, we have unraveled a distinct autoinhibition mechanism for talin in which other parts of the molecule, talin-R, control the function of the FERM domain in integrin activation. Our cell-based experiments provide direct functional evidence to support this mechanism; full-length talin was a poor activator of integrin αIIbβ3, whereas talin-H was substantially more potent (Figure 1). These data are also consistent with the report of Han et al, (2006) showing that talin must be activated to display its integrin activating activity. Furthermore, talin M319A mutation, which disrupts the talin-PTB/talin-R interaction but not talin-PTB/integrin interaction, constitutively activated αIIbβ3 (Figure 5C). These data provide strong functional evidence for talin autoinhibition in regulating integrin activation. The autoinhibitory domain was mapped to the middle region (1654-2344) of talin-R and its affinity for talin-PTB was found to be within the submicromolar range as assessed by SPR using purified components (Table 1). We note that the intramolecular interaction involving the two domains in intact talin is expected to be even stronger by placing the binding surfaces within the same molecule, and may provide the tight control of talin activity needed to prevent spontaneous integrin activation. Interestingly, despite its inhibitory conformation that prevents the talin-PTB/integrin membrane-proximal β CT contact, full-length talin can still bind weakly to integrin β CT (the affinity is about six-fold weaker than that of the talin-H/integrin interaction, see Yan et al., 2001), suggesting that the integrin binding site on talin is not completely masked. Our data are consistent with this observation in that the integrin membrane-distal CT binding site on talin-PTB does not appear to be significantly masked by talin-R. The binding of isolated talin-R to the membrane-distal region of integrin β CT (Xing et al., 2001; Yan et al., 2001; Tremuth et al., 2004) may contribute to the full length talin/integrin interaction. Based on our observations, we propose a model for how talin controls integrin activation (Figure 7). In the closed state, the integrin membrane-proximal β CT binding site on talin-H is masked by talin-R although talin can still weakly associate with integrin β CT via its unmasked sites. Upon activation by cellular stimuli, talin undergoes a conformational change so that talin-PTB can access the integrin membrane-proximal β CT, which leads to the integrin α/β CT unclasping and inside-out activation. Since talin also binds to actin via the C-terminal end of talin-R (outside talin-RM) (Gingras et al., 2008), the enhanced talin/integrin interaction, consequent to the talin conformational change, may alter integrin-actin linkage. In this manner, cells can undergo dynamic cytoskeleton remodeling, in coordination with integrin activation and ligation. A dynamic equilibrium exists between monomeric and dimeric talin, which only shifts to the dimeric state at high talin concentration (>3μM) (Molony et al., 1987), and the dimeric state may strengthen the integrin-actin linkage. Although the exact dimerization topology for full length talin is not clear, recent crystallographic studies of the C-terminal actin binding module (2300-2541) revealed a dimeric structure and suggested that the full length talin dimer may exist in three possible conformations (Gingras et al., 2008): parallel, tail-to-tail V-shaped or tail-to-tail antiparallel fashion. Earlier EM studies (Goldman et al., 1994) suggested that the two globular heads (talin-Hs) are on two opposite ends of the talin dimer and suggested a head-to-tail antiparallel dimer, which raises a possibility that the middle talin-RM in one subunit interacts with talin-H in the other. However, such head-to-tail antiparallel is incompatible with the crystallographic studies (Gingras et al., 2008) and thus intermolecular autoinhibition is less likely to occur in cells.
Figure 7
Figure 7
Model for the talin activation in inducing the integrin activation. In the closed state, the integrin membrane-proximal β CT binding site (blue bar) on talin-H is masked by talin-R, although talin can still weakly bind to integrin β CT (more ...)
What is the mechanism to trigger the conformational change of talin to expose its integrin membrane-proximal β CT site in vivo? One mechanism involves PIP2, which promotes strong talin binding to the integrin β1 CT (Martel et al., 2001). Interestingly, the PIP2-producing enzyme, PIPKIγ, is also recruited to integrin adhesion sites by talin (Ling et al., 2002; di Paolo et al., 2002), providing a mechanism for efficient PIP2/talin interaction. Our NMR and biochemical data have indicated that while the PIPKIγ binding to talin does not affect the autoinhibitory conformation of talin (Figure S6D), the PIPKIγ product, PIP2, does (Figure 6). Thus, upon agonist stimulation, talin may recruit PIPKIγ to locally enrich PIP2, which in turn induces the conformational change of talin to expose its integrin membrane-proximal β CT site, promoting high affinity talin binding to and activation of integrins. This model is supported by several independent in vivo observations: (i) integrin αIIbβ3 activation is associated with the increased PIPKIγ activity and PIP2 levels in platelets (Hinchliffe et al., 1996). (ii) PIP2 level is associated with talin on activated platelets (in which αIIbβ3 is activated) but not on resting platelets (Heraud et al., 1998); and (iii) a ternary complex involving PIP2, talin and integrin αvβ3 was formed in the living cells to mediate αvβ3 activation and clustering (Cluzel et al., 2005). Another emerging mechanism for the talin activation involves RIAM (Han et al., 2006), which forms a supramolecular complex with talin and Rap1 to activate integrins. It remains to be determined whether RIAM changes the conformation of talin in this supermolecular complex to relieve its autoinhibition. Finally, calpain cleaves talin into a talin-H/talin-R mixture, thereby releasing talin-H for enhanced binding to integrin (Yan et al., 2001). However, activation of integrin αLβ 2 by ionomycin did not involve calpain-mediated talin cleavage (Dreolini and Takei, 2007). RIAM-mediated integrin activation also does not involve calpain-dependent talin cleavage (Han et al., 2006). Most data implicate calpain in integrin outside-in signaling (Schoenwaelder et al., 1997; Hayashi et al., 1999; Franco et al., 2004).
In summary, we have demonstrated the structural basis of the autoinhibition for talin in regulating integrin activation. Our findings, together with previous structural data (Vinogradova et al., 2002; Garcia-Alvarez et al., 2003; Wegener et al., 2007), now provide a view of how a series of conformation changes occur for talin-mediated integrin activation (Figure 7).
Sample preparation for NMR analyses
A pET15b vector containing a thrombin-cleavable N-terminal His-tag GSS(H)6SSGLVPRGSHM was used to subclone the talin-H fragments, talin-F3/PTB (306-405), talin-F2F3 (206-405). A variant of pET15b, pET30a, was used to clone larger talin-R fragments, talin-R 434-947 (R1), 944-1483 (R2), 1483-1653 (R3), 1654-1848 (R4), 1841-1983 (R5), 1984-2102 (R6), 2103-2229 (R7), 2225-2344 (R8), 2338-2541 (R9), talin-RM (1654-2344) and a talin R6-R8 construct. The fragments were expressed in E. coli BL21 (DE3), and the cells were harvested and lysed using 10mg/ml lysozyme. All fragments were purified on nickel columns with 250mM imidazole in the elution buffer (50 mM phosphate buffer, 100 mM NaCl, 1mM DTT, pH 7.0). The eluted proteins were dialyzed against elution buffer, and His-tags were cleaved using thrombin. The proteins were then further purified by size exclusion chromatography on Superdex-200 (Amersham Bioscience). Talin-H was prepared as described (Vinogradova et al., 2002). To prepare 15N and/or 13C-labeled protein, the cells were grown in M9 minimal media containing 15NH4Cl and/or 13C-glucose, and all other conditions were the same as for the unlabeled proteins. To prepare 15N/90%2H-labeled talin-PTB, cells were grown in M9 minimal media containing 15NH4 Cl and 90% 2H2O. Point mutants of talin-PTB (M319A, L325R, W359A, S365D, S379R, Q381V) were made using a QuickChange site-directed mutagenesis system (Stratagene, Inc) and prepared in the same way as WT proteins. A point mutation (C336S) was also introduced in talin-PTB as reported (de Pereda et al., 2005) to improve protein stability. The β3 CT chimera peptide TIHDRKEFAKFEEERARAKWVYSPLHYSAR (the sequence in bold is PIPKIγ tail), β3 CT chimera mutant (F730A), and PIPKIγ (SWVYSPLHYSAR) were synthesized by our Biotechnology Core. For improved solubility, the KLLI sequence was not included at the N-terminus of the β3 CT since it is not involved in interacting with talin-PTB (Wegener et al., 2007). The β3 CT chimera binds tightly to talin-PTB (Kd~140 nM) in slow exchange, which mimicks the β3 CT that has weaker binding to talin-PTB in intermediate exchange (Wegener et al., 2007).
NMR spectroscopy
All heteronuclear NMR experiments were performed as described by Bax and Grazsiek, 1993. All triple resonance NMR experiments for 1mM talin-F2F3 were performed on a Varian 600 MHz instrument equipped with a triple resonance probe and shielded z-gradient unit. These experiments were performed at 25°C, pH 7.0, in 150mM NaCl, 50 mM phosphate buffer, 1mM DTT. The chemical shift assignments of talin-F2F3 have been deposited in BMRB (code 15792). All HSQC experiments were performed on Bruker Avance 600 or 900 MHz spectrometers using the cryogenic triple resonance probes. 15N-labeled and/or 15N/90%2H-labeled talin-PTB or talin-F2F3 (0.2 mM) were used with and without the talin-R fragments at 1:2 ratio in all HSQC experiments. For chemical shift mapping, TROSY-based HSQC (Pervushin et al., 1997) for talin-PTB or talin-F2F3 in complex with talin-RM were performed on a Bruker 900 MHz spectrometer. Weighted chemical shift changes were calculated using the equation: Δδobs[HN,N]=([ΔδHNWHN]2+[ΔδNWN]2)1/2, where WHN=1 and WN=0.154 are weighting factors based on the gyromagnetic ratios of 1H and 15N. All the spectra were processed with nmrPipe (Delaglio et al., 1995) and visualized with PIPP (Garrett et al., 1991).
Surface Plasmon Resonance (SPR) Measurements
SPR was performed using a BIA Core 3000 instrument (Amersham Pharmacia Biotech). CM5 sensor chips were activated using the amine coupling kit from Amersham Pharmacia Biotech. Talin-RM was immobilized to the activated surface, and talin-PTB and its mutants were injected at 0.1-5 μM and flow s of 20μl/min. rate For PIP2/talin-H interaction, biotinylated C6-PIP2 (C-45B6a, echelon Biosciences, Inc) was immobilized on a biotin chip and talin-H was injected at 20μl/min. Experiments were performed at 37°C in 10 mM Hepes, pH 7.4. Binding affinities were calculated using the BIAcore 3000 evaluation software (Biacore AB, Uppsala, Sweden).
Plasmids and transfections
Plasmid DNA encoding full-length mouse talin was kindly provided by Richard Hynes, MIT, and it was cloned into pEGFP-N1 vector (Clontech Lab, Inc) encoding a red-shifted variant of WT GFP using EcoRI and AgeI restriction sites. The final DNA had a C-terminal GFP fusion and was confirmed by sequencing. Full length talin M319A DNA mutant was prepared employing the QuickChange Site-Directed Mutagenesis Kit (Stratagene) using the cloned GFP-fusion talin DNA as a template. The resulting mutant DNA was confirmed by sequencing.
Integrin activation
The effects of full-length talin, full length talin M319A, and talin-H on integrin activation were analyzed using αIIbβ3-CHO and an activation-specific mAb (PAC1) as described previously (Ma et al., 2008) Briefly, αIIbβ3-CHO cells were transfected with EGFP-talin, EGFP-talin-H or EGFP vector alone; 24 hours after transfection, the cells were harvested and stained with PAC1 followed by Alexa Fluor® 633 goat anti-mouse IgM conjugate. After washing, the cells were fixed and analyzed on a FACSCalibur instrument (BD Scientific, Franklin Lakes, NJ). PAC1 binding was analyzed only on a gated subset of cells positive for EGFP expression. The mean fluorescence intensities of PAC1 bound to the EGFP-talin or EGFP-talin-H expressing cells were compared to that of PAC1 bound to the control EGFP expressing cells. Three independent experiments were performed, and the T-student test was used for statistical analyses.
Supplementary Material
01
Acknowledgements
This work was supported by NIH grants awarded to J.Q. ((HL5875) and to J.Q and E.F.P.(P01HL073311). We thank Xi-An Mao, Sujay Ithychanda, Jun Yang, Keyang Ding, Jianmin Liu, Julia Vaynberg for assistance and useful discussions.
Footnotes
This is a PDF file of an unedited manuscript that has been accepted for publication. As a service to our customers we are providing this early version of the manuscript. The manuscript will undergo copyediting, typesetting, and review of the resulting proof before it is published in its final citable form. Please note that during the production process errors may be discovered which could affect the content, and all legal disclaimers that apply to the journal pertain.
  • Bax A, Grzesiek S. Methodological advances in protein NMR. Accounts Chem. Res. 1993;26:131–138.
  • Bompard G, Martin M, Roy C, Vignon F, Freiss G. Membrane targeting of protein tyrosine phosphatase PTPL1 through its FERM domain via binding to phosphatidylinositol 4,5-biphosphate. J Cell Sci. 2003;116(Pt 12):2519–30. [PubMed]
  • Bonvin AM, Boelens R, Kaptein R. NMR analysis of protein interactions. Curr Opin Chem Biol. 2005;9(5):501–8. [PubMed]
  • Bouaouina M, Lad Y, Calderwood DA. The N-terminal domains of talin co-operate with the PTB-like domain to activate beta 1 and beta 3 integrins. J Biol Chem. 2007 Epub ahead of print. [PubMed]
  • Bryson K, McGuffin LJ, Marsden RL, Ward JJ, Sodhi JS, Jones DT. Protein structure prediction servers at University College London. Nucleic Acids Res. 2005;33:W36–8. Web Server issue. [PMC free article] [PubMed]
  • Burridge K, Connell L. Talin: a cytoskeletal component concentrated in adhesion plaques and other sites of actin-membrane interaction. Cell Motil. 1983;3(56):405–17. [PubMed]
  • Cai X, Lietha D, Ceccarelli DF, Karginov AV, Rajfur Z, Jacobson K, Hahn KM, Eck MJ, Schaller MD. Spatial and temporal regulation of focal adhesion kinase activity in living cells. Mol Cell Biol. 2008;28(1):201–14. [PMC free article] [PubMed]
  • Calderwood DA, Zent R, Grant R, Rees DJ, Hynes RO, Ginsberg MH. The Talin head domain binds to integrin beta subunit cytoplasmic tails and regulates integrin activation. J Biol Chem. 1999;274:28071–4. [PubMed]
  • Calderwood DA, Shattil SJ, Ginsberg MH. Integrins and actin filaments: reciprocal regulation of cell adhesion and signaling. J Biol Chem. 2000;275(30):22607–10. [PubMed]
  • Calderwood DA, Yan B, de Pereda JM, Alvarez BG, Fujioka Y, Liddington RC, Ginsberg MH. The phosphotyrosine binding-like domain of talin activates integrins. J Biol Chem. 2002;277(24):21749–58. [PubMed]
  • Calderwood DA. Talin controls integrin activation. Biochem Soc Trans. 2004;32(Pt3):434–7. [PubMed]
  • Cluzel C, Saltel F, Lussi J, Paulhe F, Imhof BA, Wehrle-Haller B. The mechanisms and dynamics of {alpha}v{beta}3 integrin clustering in living cells. J Cell Biol. 2005;171(2):383–92. [PMC free article] [PubMed]
  • Delaglio F, Grzesiek S, Vuister GW, Zhu G, Pfeifer J, Bax A. NMRPipe: A multidimensional spectral processing system based on UNIX pipes. J. Bio. NMR. 1995;6:277–293. [PubMed]
  • de Pereda JM, Wegener KL, Santelli E, Bate N, Ginsberg MH, Critchley DR, Campbell ID, Liddington RC. Structural basis for phosphatidylinositol phosphate kinase type Igamma binding to talin at focal adhesions. J. Biol. Chem. 2005;280:8381–8386. [PubMed]
  • Di Paolo G, Pellegrini L, Letinic K, Cestra G, Zoncu R, Voronov S, Chang S, Guo J, Wenk MR, De Camilli P. Recruitment and regulation of phosphatidylinositol phosphate kinase type 1 gamma by the FERM domain of talin. Nature. 2002;420:85–89. [PubMed]
  • Dreolini L, Takei F. Activation of LFA-1 by ionomycin is independent of calpain-mediated talin cleavage. Biochem Biophys Res Commun. 2007;356(1):207–12. [PubMed]
  • Fillingham I, Gingras AR, Papagrigoriou E, Patel B, Emsley J, Critchley DR, Roberts GC, Barsukov IL. A vinculin binding domain from the talin rod unfolds to form a complex with the vinculin head. Structure. 2005;13(1):65–74. [PubMed]
  • Franco SJ, Rodgers MA, Perrin BJ, Han J, Bennin DA, Critchley DR, Huttenlocher A. Calpain-mediated proteolysis of talin regulates adhesion dynamics. Nat Cell Biol. 2004;6(10):977–83. [PubMed]
  • García-Alvarez B, de Pereda JM, Calderwood DA, Ulmer TS, Critchley D, Campbell ID, Ginsberg MH, Liddington RC. Structural determinants of integrin recognition by talin. Mol. Cell. 2003;11:49–58. [PubMed]
  • Garrett DS, Powers R, Gronenborn AM, Clore GM. A common sense approach to peak picking in two- three- and four-dimensional spectra using automatic computer analysis of contour diagrams. J. Magn. Reson. 1991;95:214–220. [PubMed]
  • Gingras AR, Bate N, Goult BT, Hazelwood L, Canestrelli I, Grossmann JG, Liu H, Putz NS, Roberts GC, Volkmann N, Hanein D, Barsukov IL, Critchley DR. The structure of the C-terminal actin-binding domain of talin. EMBO J. 2008;27:458–69. [PMC free article] [PubMed]
  • Goldmann WH, Bremer A, Häner M, Aebi U, Isenberg G. Native talin is a dumbbell-shaped homodimer when it interacts with actin. J Struct Biol. 1994;112(1):3–10. [PubMed]
  • Hamada K, Shimizu T, Matsui T, Tsukita S, Hakoshima T. Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain. EMBO J. 2000;19(17):4449–62. [PubMed]
  • Han J, Lim CJ, Watanabe N, Soriani A, Ratnikov B, Calderwood DA, Puzon-McLaughlin W, Lafuente EM, Boussiotis VA, Shattil SJ, Ginsberg MH. Reconstructing and deconstructing agonist-induced activation of integrin alphaIIbbeta3. Curr Biol. 2006;16(18):1796–806. [PubMed]
  • Hayashi M, Suzuki H, Kawashima S, Saido TC, Inomata M. The behavior of calpain-generated N- and C-terminal fragments of talin in integrin-mediated signaling pathways. Arch Biochem Biophys. 1999;371(2):133–41. [PubMed]
  • Heraud JM, Racaud-Sultan C, Gironcel D, Albigès-Rizo C, Giacomini T, Roques S, Martel V, Breton-Douillon M, Perret B, Chap H. Lipid products of phosphoinositide 3-kinase and phosphatidylinositol 4′,5′-bisphosphate are both required for ADP-dependent platelet spreading. J Biol Chem. 1998;273(28):17817–23. [PubMed]
  • Hinchliffe KA, Irvine RF, Divecha N. Aggregation-dependent, integrin-mediated increases in cytoskeletally associated PtdInsP2 (4,5) levels in human platelets are controlled by translocation of PtdIns 4-P 5-kinase C to the cytoskeleton. EMBO J. 1996;15(23):6516–24. [PubMed]
  • Hynes RO. Integrins: bidirectional, allosteric signaling machines. Cell. 2002;110:673–687. [PubMed]
  • Kim M, Carman CV, Springer TA. Bidirectional transmembrane signaling by cytoplasmic domain separation in integrins. Science. 2003;301:1720–1725. [PubMed]
  • Lee SY, Voronov S, Letinic K, Nairn AC, Di Paolo G, De Camilli P. Regulation of the interaction between PIPKI gamma and talin by proline-directed protein kinases. J Cell Biol. 2005;168(5):789–99. [PMC free article] [PubMed]
  • Li Q, Nance MR, Kulikauskas R, Nyberg K, Fehon R, Karplus PA, Bretscher A, Tesmer JJ. Self-masking in an intact ERM-merlin protein: an active role for the central alpha-helical domain. J Mol Biol. 2007;365(5):1446–59. [PMC free article] [PubMed]
  • Lietha D, Cai X, Ceccarelli DF, Li Y, Schaller MD, Eck MJ. Structural basis for the autoinhibition of focal adhesion kinase. Cell. 2007;129(6):1177–87. [PMC free article] [PubMed]
  • Ling K, Doughman RL, Firestone AJ, Bunce MW, Anderson RA. Type I gamma phosphatidylinositol phosphate kinase targets and regulates focal adhesions. Nature. 2002;420:89–93. [PubMed]
  • Ma YQ, Yang J, Pesho MM, Vinogradova O, Qin J, Plow EF. Regulation of Integrin alpha(IIb)beta(3) Activation by Distinct Regions of Its Cytoplasmic Tails. Biochemistry. 2006;45:6656–6662. [PubMed]
  • Ma YQ, Qin J, Wu C, Plow EF. Kindlin-2 (Mig-2): a co-activator of beta3 integrins. J. Cell Biol. 2008;181(3):439–46. [PMC free article] [PubMed]
  • McLachlan AD, Stewart M, Hynes RO, Rees DJ. Analysis of repeated motifs in the talin rod. J Mol Biol. 1994;235(4):1278–90. [PubMed]
  • Martel V, Racaud-Sultan C, Dupe S, Marie C, Paulhe F, Galmiche A, Block MR, Albiges-Rizo C. Conformation, localization, and integrin binding of talin depend on its interaction with phosphoinositides. J. Biol. Chem. 2001;276:21217–21227. [PubMed]
  • Nieswandt B, Moser M, Pleines I, Varga-Szabo D, Monkley S, Critchley D, Fässler R. Loss of talin1 in platelets abrogates integrin activation, platelet aggregation, and thrombus formation in vitro and in vivo. J Exp Med. 2007;204(13):3113–8. [PMC free article] [PubMed]
  • Papagrigoriou E, Gingras AR, Barsukov IL, Bate N, Fillingham IJ, Patel B, Frank R, Ziegler WH, Roberts GC, Critchley DR, Emsley J. Activation of a vinculin-binding site in the talin rod involves rearrangement of a five-helix bundle. EMBO J. 2004;23(15):2942–51. [PubMed]
  • Pearson MA, Reczek D, Bretscher A, Karplus PA. Structure of the ERM protein moesin reveals the FERM domain fold masked by an extended actin binding tail domain. Cell. 2000;101(3):259–70. [PubMed]
  • Pervushin K, Riek R, Wider G, Wüthrich K. Attenuated T2 relaxation by mutual cancellation of dipole-dipole coupling and chemical shift anisotropy indicates an avenue to NMR structures of very large biological macromolecules in solution. Proc Natl Acad Sci U S A. 1997;94(23):12366–71. [PubMed]
  • Petrich BG, Marchese P, Ruggeri ZM, Spiess S, Weichert RA, Ye F, Tiedt R, Skoda RC, Monkley SJ, Critchley DR, Ginsberg MH. Talin is required for integrin-mediated platelet function in hemostasis and thrombosis. J Exp Med. 2007;204(13):3103–11. [PMC free article] [PubMed]
  • Rees DJ, Ades SE, Singer SJ, Hynes RO. Sequence and domain structure of talin. Nature. 1990;347:685–689. [PubMed]
  • Schoenwaelder SM, Yuan Y, Cooray P, Salem HH, Jackson SP. Calpain cleavage of focal adhesion proteins regulates the cytoskeletal attachment of integrin alphaIIbbeta3 (platelet glycoprotein IIb/IIIa) and the cellular retraction of fibrin clots. J Biol Chem. 1997;272(3):1694–702. [PubMed]
  • Tadokoro S, Shattil SJ, Eto K, Tai V, Liddington RC, de Pereda JM, Ginsberg MH, Calderwood DA. Talin binding to integrin beta tails: a final common step in integrin activation. Science. 2003;302:103–106. [PubMed]
  • Takeuchi K, Wagner G. NMR studies of protein interactions. Curr Opin Struct Biol. 2006;16(1):109–17. [PubMed]
  • Tremuth L, Kreis S, Melchior C, Hoebeke J, Rondé P, Plançon S, Takeda K, Kieffer N. A fluorescence cell biology approach to map the second integrin-binding site of talin to a 130-amino acid sequence within the rod domain. J Biol Chem. 2004;279(21):22258–66. [PubMed]
  • Turner CE, Burridge K. Transmembrane molecular assemblies in cell-extracellular matrix interactions. Curr Opin Cell Biol. 1991;3(5):849–53. [PubMed]
  • Vaynberg J, Qin J. Weak protein-protein interactions as probed by NMR spectroscopy. Trends in Biotechnology. 2006;24(1):22–7. [PubMed]
  • Vinogradova O, Velyvis A, Velyviene A, Hu B, Haas T, Plow E, Qin J. A structural mechanism of integrin alpha(IIb)beta(3) “inside-out” activation as regulated by its cytoplasmic face. Cell. 2002;110:587–597. [PubMed]
  • Vinogradova O, Vaynberg J, Kong X, Haas TA, Plow EF, Qin J. Membrane-mediated structural transitions at the cytoplasmic face during integrin activation. Proc. Natl. Acad. Sci. U S A. 2004;101:4094–4099. [PubMed]
  • Xing B, Jedsadayanmata A, Lam SC. Localization of an integrin binding site to the C terminus of talin. J Biol Chem. 2001;276(48):44373–8. [PubMed]
  • Yan B, Calderwood DA, Yaspan B, Ginsberg MH. Calpain cleavage promotes talin binding to the beta 3 integrin cytoplasmic domain. J. Biol. Chem. 2001;276:28164–28170. [PubMed]
  • Wegener KL, Partridge AW, Han J, Pickford AR, Liddington RC, Ginsberg MH, Campbell ID. Structural basis of integrin activation by talin. Cell. 2007;128(1):171–82. [PubMed]