PMCCPMCCPMCC

Search tips
Search criteria 

Advanced

Logo of mmbrPermissionsJournals.ASM.orgJournalMMBR ArticleJournal InfoAuthorsReviewers
 
From:
doi: 10.1128/MMBR.70.1.157-176.2006
TABLE 4.
Characteristics and sequence motifs of putative levansucrase (LS) and inulosucrase (IS) enzymes identified in LAB genome sequencesa
OrganismAccession no.Size (amino acids)Sequence
Positions of core region
Sucrose box 1Sucrose box 2RDPE211 Z. mobilisAcid-base catalystR331 B. subtilis
S. mutans UA159 putative ISAE015025795EWSGSLFYTKVDLRDPHVFEASTVSDELERSRLNH173-636
L. johnsonii NCC533 putative ISRLJO00913797QWSGSLYYTKVDMRDAHVFEASTVSDEIERTRLNR200-663
L. gasseri ATCC 33323 putative ISRLGA00517630QWSGSLYYTKVDMRDAHVFEASTVSDEIERTRLNR173-630
L. mesenteroides ATCC 8293 putative LSRLME017751,015QWSGSLYYTKVDLRDPHAFEANTITDEIERTRLSK171-622
L. mesenteroides ATCC 8293 putative LSRLME01776782QWSGSLFYTKTDLRDPHTFESNTITDEIERTRLSK166-618
L. mesenteroides ATCC 8293 putative LSRLME017801,002QWSGSLFYTQVDLRDPHTFEGSTVTDEIERARLDR167-611
L. reuteri 121 Inu EC 2.4.1.9AAN05575798EWSGSLFYTRVDMRDAHVFEASTVSDEIERTRLNR200-662
L. reuteri 121 Lev EC 2.4.1.10AAO14618804EWSGSLFFTSNDLRDPHVFEANTASDEVERTRVSR177-642
aAs references, L. reuteri (121) Inu and Lev are shown (boldface). The nucleophile and acid-base catalysts have been identified in B. subtilis SacB and L. reuteri (121) Lev and Inu proteins (113, 140). Residues or motifs indicated in the top row: the RDP motif (Fig. (Fig.3E),3E), initially identified in the G. diazotrophicus levansucrase (9); E211 residue, identified in the Z. mobilis levansucrase (220); and R331 residue, identified in the B. subtilis levansucrase (22). Sucrose binding boxes 1 and 2 are further discussed in the legend to Fig. Fig.33.
Articles from Microbiology and Molecular Biology Reviews : MMBR are provided here courtesy of
American Society for Microbiology (ASM)